PSCA Protein, Mouse (P.pastoris, His)
PSCA protein is a multifunctional regulator that may modulate cell proliferation and act as a modulator of nicotinic acetylcholine receptor (nAChR) activity. In vitro experiments showed that it can inhibit nicotine-induced signaling, suggesting interaction with nAChR containing α-3:β-2 or α-7. PSCA Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PSCA protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PSCA protein is a multifunctional regulator that may modulate cell proliferation and act as a modulator of nicotinic acetylcholine receptor (nAChR) activity. In vitro experiments showed that it can inhibit nicotine-induced signaling, suggesting interaction with nAChR containing α-3:β-2 or α-7. PSCA Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PSCA protein, expressed by P. pastoris , with N-His labeled tag.
The PSCA protein emerges as a versatile regulator, potentially involved in the modulation of cell proliferation and acting as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro experiments demonstrate its ability to inhibit nicotine-induced signaling, suggesting a potential interaction with alpha-3:beta-2- or alpha-7-containing nAChRs. The dual functionality of PSCA, influencing both cell proliferation and nicotinic acetylcholine receptor activity, underscores its significance in cellular processes and signaling pathways, hinting at its potential role in the intricate balance of cellular homeostasis.
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag N-His
-
Accession
P57096 (L21-N95)
-
Molecular Construction
-
N-term
-
His
-
PSCA (L21-N95)
Accession # P57096 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PSCA; LncPSCA; Prostate Stem Cell Antigen; PRO232
-
AA Sequence
LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN
-
Predicted Molecular Mass
10.4 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
