PSMA3 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

PSMA3 is a protein involved in protein degradation. PSMA3 Protein, Human (His) is the recombinant human-derived PSMA3 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PSMA3 is a protein involved in protein degradation. PSMA3 Protein, Human (His) is the recombinant human-derived PSMA3 protein, expressed by E. coli , with N-His labeled tag.

Background

PSMA3, a crucial component of the 20S core proteasome complex, plays a pivotal role in the ATP-dependent degradation of ubiquitinated proteins, contributing to the maintenance of protein homeostasis. When associated with two 19S regulatory particles, it forms the 26S proteasome, which is integral in removing misfolded or damaged proteins to preserve cellular functions. In conjunction with PA200 or PA28, the 20S proteasome facilitates ubiquitin-independent protein degradation, vital for processes like spermatogenesis and the generation of MHC class I-presented antigenic peptides. PSMA3 also binds to the C-terminus of CDKN1A, mediating its degradation, and negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor isoform 2. The 26S proteasome, comprising a 20S proteasome core and two 19S regulatory subunits, functions as a barrel-shaped complex made of 28 subunits arranged in four stacked rings. The proteolytic activity of the 20S core is executed by three beta-subunits, PSMB5, PSMB6, and PSMB7. PSMA3 further engages in protein interactions with AURKB, CDKN1A, MDM2, RB1, TBXA2R isoform 2, and DNAJB2, underscoring its versatile roles in cellular regulatory pathways.

Verified Bioactivity

Measured by its ability to inhibit the proliferation of SK-OV-3 cells. The ED50 for this effect is 0.1116 μg/mL, Corresponding to a specific activity is 8.960×103 Unit/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the proliferation of SK-OV-3 cells. The ED50 for this effect is 0.1116 μg/mL, Corresponding to a specific activity is 8.960×103 Unit/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • PSMA3 (M1-M255)
      Accession # P25788-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PSMA3; Proteasome Subunit Alpha 3; Proteasome 20S Subunit Alpha 3; Alpha-7; HC8; Testicular Secretory Protein Li 43; Multicatalytic Endopeptidase Complex Subunit C8; Proteasome Subunit Alpha Type; Proteasome Subunit Alpha Type-3; Proteasome Subunit Alpha7

  • AA Sequence

    MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

  • Molecular Weight

    Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00