PSMA3 Protein, Human (His)
Based on 1 Customer Validation
PSMA3 is a protein involved in protein degradation. PSMA3 Protein, Human (His) is the recombinant human-derived PSMA3 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
PSMA3 is a protein involved in protein degradation. PSMA3 Protein, Human (His) is the recombinant human-derived PSMA3 protein, expressed by E. coli , with N-His labeled tag.
PSMA3, a crucial component of the 20S core proteasome complex, plays a pivotal role in the ATP-dependent degradation of ubiquitinated proteins, contributing to the maintenance of protein homeostasis. When associated with two 19S regulatory particles, it forms the 26S proteasome, which is integral in removing misfolded or damaged proteins to preserve cellular functions. In conjunction with PA200 or PA28, the 20S proteasome facilitates ubiquitin-independent protein degradation, vital for processes like spermatogenesis and the generation of MHC class I-presented antigenic peptides. PSMA3 also binds to the C-terminus of CDKN1A, mediating its degradation, and negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor isoform 2. The 26S proteasome, comprising a 20S proteasome core and two 19S regulatory subunits, functions as a barrel-shaped complex made of 28 subunits arranged in four stacked rings. The proteolytic activity of the 20S core is executed by three beta-subunits, PSMB5, PSMB6, and PSMB7. PSMA3 further engages in protein interactions with AURKB, CDKN1A, MDM2, RB1, TBXA2R isoform 2, and DNAJB2, underscoring its versatile roles in cellular regulatory pathways.
Measured by its ability to inhibit the proliferation of SK-OV-3 cells. The ED50 for this effect is 0.1116 μg/mL, Corresponding to a specific activity is 8.960×103 Unit/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P25788-1 (M1-M255)
-
Molecular Construction
-
N-term
-
His
-
PSMA3 (M1-M255)
Accession # P25788-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PSMA3; Proteasome Subunit Alpha 3; Proteasome 20S Subunit Alpha 3; Alpha-7; HC8; Testicular Secretory Protein Li 43; Multicatalytic Endopeptidase Complex Subunit C8; Proteasome Subunit Alpha Type; Proteasome Subunit Alpha Type-3; Proteasome Subunit Alpha7
-
AA Sequence
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)