PVRIG Protein, Mouse (HEK293, Fc)
PVRIG Protein, a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG blocking antibodies significantly increased NK-cell cytotoxicity. PVRIG Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PVRIG protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PVRIG Protein, a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG blocking antibodies significantly increased NK-cell cytotoxicity. PVRIG Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PVRIG protein, expressed by HEK293 , with C-hFc labeled tag.
Background
Poliovirus receptor related immunoglobulin domain containing (PVRIG), a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. In humans, PVRIG is expressed on T cells (predominantly CD8+ T cells) and natural killer (NK) cells, but not on B cells, monocytes or neutrophils. PVRIG binds to a single ligand, poliovirus receptor-related 2 (PVRL2), and exerts an inhibitory effect on cytotoxic lymphocyte activity, likely via an ITIM-like motif in its intracellular domain. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG deficiency or PVRIG blockade can reduce the tumor size and prolong the survival of tumor-bearing mice through inhibiting NK cell and CD8+ T cell exhaustion. PVRIG blockade enhances natural killer cell killing of PVRL2hiPVRlo acute myeloid leukemia cells[1][2][3].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
A0A1B0GS01 (S35-D165)
-
Molecular Construction
-
N-term
-
PVRIG (S35-D165)
Accession # A0A1B0GS01 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
PVRIG; Poliovirus Receptor-Related Immunoglobulin Domain-Containing Protein; PVR Related Immunoglobulin Domain Containing; Poliovirus Receptor Related Immunoglobulin Domain Containing; C7orf15; Transmembrane Protein PVRIG; CD112R; Nectin-2 Receptor; CD112
-
AA Sequence
SPEVWVQVQMEATNLSSFSVHCGVLGYSLISLVTVSCEGFVDAGRTKLAVLHPEFGTQQWAPARQAHWETPNSVSVTLTMGQSKARSSLANTTFCCEFVTFPHGSRVACRDLHRSDPGLSAPTPALNLQAD
-
Predicted Molecular Mass
41.1 kDa
-
Molecular Weight
Approximately 48-55 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)