1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands RANKL/CD254
  5. RANKL/TNFSF11 Protein, Human (Biotinylated, HEK293, Fc-Avi)

RANKL/TNFSF11 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P78817
Handling Instructions Technical Support

RANKL/TNFSF11 protein is a cytokine that binds to TNFRSF11B/OPG and TNFRSF11A/RANK and serves as a key regulator of osteoclast differentiation and activation. In addition, it is a factor that enhances the ability of dendritic cells to stimulate naive T cell proliferation, indicating its importance in regulating the interaction between T cells and dendritic cells, as well as its potential role in T cell-dependent immune responses. RANKL/TNFSF11 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived RANK L/TNFSF11 protein, expressed by HEK293 , with N-hFc, N-Avi labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RANKL/TNFSF11 protein is a cytokine that binds to TNFRSF11B/OPG and TNFRSF11A/RANK and serves as a key regulator of osteoclast differentiation and activation. In addition, it is a factor that enhances the ability of dendritic cells to stimulate naive T cell proliferation, indicating its importance in regulating the interaction between T cells and dendritic cells, as well as its potential role in T cell-dependent immune responses. RANKL/TNFSF11 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived RANK L/TNFSF11 protein, expressed by HEK293 , with N-hFc, N-Avi labeled tag.

Background

RANK L/TNFSF11 protein, a cytokine, binds to TNFRSF11B/OPG and TNFRSF11A/RANK, functioning as a crucial regulator of osteoclast differentiation and activation. Additionally, it serves as a factor that enhances the ability of dendritic cells to stimulate naive T-cell proliferation, suggesting its importance in the regulation of T-cell and dendritic cell interactions, and a potential role in the T-cell-dependent immune response. Moreover, RANK L/TNFSF11 may play a significant role in enhanced bone resorption observed in conditions like humoral hypercalcemia of malignancy. Its induction of osteoclastogenesis involves the activation of multiple signaling pathways in osteoclast precursor cells, with a key mechanism being the induction of long-lasting oscillations in intracellular calcium concentration, leading to the activation of NFATC1. This transcription factor translocates to the nucleus and initiates osteoclast-specific gene transcription, facilitating osteoclast differentiation. During this process, RANK L/TNFSF11, in a TMEM64 and ATP2A2-dependent manner, induces CREB1 activation and mitochondrial ROS generation, crucial for proper osteoclast formation. Existing as a homotrimer, RANK L/TNFSF11 interacts with TNFRSF11B, TNFRSF11A, FBN1, and TNFAIP6, highlighting its versatile interactions in diverse cellular contexts.

Biological Activity

Immobilized Human RANK mFc at 0.5 μg/mL (100 μL/well) can bind Biotinylated Human TNFSF11 Avi-Fc with a linear range of 0.4-13 ng/mL.

Species

Human

Source

HEK293

Tag

N-hFc;N-Avi

Accession

AAC51762 (G64-D245)

Gene ID
Protein Length

Partial

Conjugation

Biotin

Synonyms
RANKL; CD254; TRANCE; OPGL; ODF
AA Sequence

GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWGKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Predicted Molecular Mass
49.2 kDa
Molecular Weight

Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RANKL/TNFSF11 Protein, Human (Biotinylated, HEK293, Fc-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RANKL/TNFSF11 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P78817
Quantity:
MCE Japan Authorized Agent: