Copy Link Print Information

RANKL/TNFSF11 Protein, Human

11 Cited Publications
Customer Review

Based on 11 publication(s) in Google Scholar

RANKL (TNFSF11), a type II transmembrane protein, is receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Human is a recombinant human RANKL (I140-D317) without any tag, which is produced in E.coli.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • RANKL/TNFSF11 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

RANKL (TNFSF11), a type II transmembrane protein, is receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Human is a recombinant human RANKL (I140-D317) without any tag, which is produced in E.coli[1][2].

Background

RANKL (TNFSF11) belongs to TNF family. RANKL is a type II transmembrane protein and is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. RANKL binds to RANK and induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. In bone tissue, RANKL is expressed by osteoblasts, osteocytes and immune cells, especially in osteoblasts and osteocytes[1]. RANKL is also expressed by T cells and increases proliferation and survival of dendritic cells[2].
Human RANKL shares 82.02% and 84.44% common aa identity with mouse and rat respectively. Human RANKL consists of cytoplasmic domain (1-47), helical domain (48-68), and extracellular domain (69-317). The soluble chain (140-317) is released when cleaved by enzymes such as matrix metalloproteinases (MMP3 or 7) and ADAM[1][3].
RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs)[1].

In Vitro

RANKL (human, 0-50 ng/mL, 24 h) stimulates migration of a clear cell RCC cell line, Caki-1[4].
RANKL (human, 24 h) stimulates PAa cell migration and invasion[5].

In Vivo

RANKL (human, 0.4 or 2 mg/kg/day, s.c.) induces high bone turnover and decreases bone volume, density, and strength in C57BL/6J female mice[6].

Verified Bioactivity

1.Immobilized Recombinant Human RANK L at 10 μg/mL (100 μL/well) can bind Recombinant Human RANK (HY-P72484). The ED50 for this effect is <3.23 μg/mL.
2.Immobilized Human RANK/TNFRSF11A at 0.5 μg/mL can bind Biotinylated Human RANKL. The ED50 for this effect is < 15 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human RANK/TNFRSF11A Protein is coated at 0.5 μg/mL (100 μL/well) can bind Biotinylated Human RANKL/TNFSF11. The ED50 for this effect is 7.413 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    O14788-1 (I140-D317)

  • Gene ID
    8600  [NCBI]
  • Molecular Construction
    • N-term
    • RANKL (I140-D317)
      Accession # O14788
    • C-term
  • Protein Length

    Full Length of TNFSF11, soluble form

  • Synonyms

    TNFSF11; Tumor Necrosis Factor (Ligand) Superfamily, Member 11; TNF Superfamily Member 11; Receptor Activator Of Nuclear Factor Kappa-B Ligand; TRANCE; TNLG6B; RANKL; Receptor Activator Of Nuclear Factor Kappa B Ligand; OPGL; Tumor Necrosis Factor Ligand

  • AA Sequence

    IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Ono T, et al. RANKL biology: bone metabolism, the immune system, and beyond. Inflamm Regen. 2020 Feb 7;40:2. [Content Brief]

[2]. Hofbauer LC, et al. Role of receptor activator of nuclear factor-kappaB ligand and osteoprotegerin in bone cell biology. J Mol Med (Berl). 2001 Jun;79(5-6):243-53. [Content Brief]

[3]. Li B, et al. Roles of the RANKL-RANK Axis in Immunity-Implications for Pathogenesis and Treatment of Bone Metastasis. Front Immunol. 2022 Mar 21;13:824117. [Content Brief]

[4]. Tobeiha M, et al. RANKL/RANK/OPG Pathway: A Mechanism Involved in Exercise-Induced Bone Remodeling. Biomed Res Int. 2020 Feb 19;2020:6910312. [Content Brief]

[5]. Mikami S, et al. Increased RANKL expression is related to tumour migration and metastasis of renal cell carcinomas. J Pathol. 2009 Aug;218(4):530-9. [Content Brief]

[6]. Peng X, et al. Differential expression of the RANKL/RANK/OPG system is associated with bone metastasis in human non-small cell lung cancer. PLoS One. 2013;8(3):e58361. [Content Brief]

[7]. Lloyd SA, et al. Soluble RANKL induces high bone turnover and decreases bone volume, density, and strength in mice. Calcif Tissue Int. 2008 May;82(5):361-72. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Human RANK/TNFRSF11A Protein is coated at 0.5 μg/mL (100 μL/well) can bind Biotinylated Human RANKL/TNFSF11. The ED50 for this effect is 7.413 ng/mL.

  • 1/16

    RANKL/TNFSF11 Protein, Human purchased from MedChemExpress. Usage Cited in: Biochem Pharmacol. 2024 Nov:229:116519. [Abstract]

    Customer Validation
     RANKL/TNFSF11 Protein, Human (50 ng/mL; 3 days) induced Osteoclastic differentiation in RAW264.7 cells.

  • 1/16

    RANKL/TNFSF11 Protein, Human purchased from MedChemExpress. Usage Cited in: Biochem Pharmacol. 2024 Nov:229:116519. [Abstract]

    Customer Validation
     RANKL/TNFSF11 Protein, Human (50 ng/mL; 3 days) suppressed NFATC1, CTSK, and MMP9 mRNA expression in RAW264.7 cells.

  • 1/16

    RANKL/TNFSF11 Protein, Human purchased from MedChemExpress. Usage Cited in: Biochem Pharmacol. 2024 Nov:229:116519. [Abstract]

    Customer Validation
     RANKL/TNFSF11 Protein, Human (50 ng/mL; 5 days) showed downregulation of NR3C1, which impaired osteoclast differentiation in BMDM.

  • 1/16

    RANKL/TNFSF11 Protein, Human purchased from MedChemExpress. Usage Cited in: Bioengineered. 2021 Dec;12(2):11784-11796. [Abstract]

    Customer Validation
     RANKL/TNFSF11 Protein, Human (100 ng/mL) decreased cell viability in 3T3-L1 cells.

  • 1/16

    RANKL/TNFSF11 Protein, Human purchased from MedChemExpress. Usage Cited in: Bioengineered. 2021 Dec;12(2):11784-11796. [Abstract]

    Customer Validation
     RANKL/TNFSF11 Protein, Human (100 ng/mL) markedly reversed the effect of TNF-α on IL-6 secretion in 3T3-L1 cells.

  • 1/16

    RANKL/TNFSF11 Protein, Human purchased from MedChemExpress. Usage Cited in: Bioengineered. 2021 Dec;12(2):11784-11796. [Abstract]

    Customer Validation
     RANKL/TNFSF11 Protein, Human (100 ng/mL) resulted in a higher suppression of Bcl-2 expression and a higher increase in the expression of cleaved caspase-3 compared to the effects of only BBR+Rb1.

  • 1/16

    RANKL/TNFSF11 Protein, Human purchased from MedChemExpress. Usage Cited in: Bioengineered. 2021 Dec;12(2):11784-11796. [Abstract]

    Customer Validation
     RANKL/TNFSF11 Protein, Human (100 ng/mL) increased the sum of area significantly in 3T3-L1 cells. Adipogenesis was evaluated by performing oil red O staining assay.

  • 1/16

    RANKL/TNFSF11 Protein, Human purchased from MedChemExpress. Usage Cited in: Bioengineered. 2021 Dec;12(2):11784-11796. [Abstract]

    Customer Validation
     RANKL/TNFSF11 Protein, Human (100 ng/mL) showed the r fluorescence intensity of NF-κB p65 was significantly increased 3T3-L1 cells.

  • RANKL/TNFSF11 Protein, Human Product Image
    1/16
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human
  • RANKL/TNFSF11 Protein, Human Product Image