1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands RANKL/CD254
  5. RANKL
  6. RANKL/TNFSF11 Protein, Human

RANKL/TNFSF11 Protein, Human

Cat. No.: HY-P7424
COA Handling Instructions

RANKL (TNFSF11), a type II transmembrane protein, is receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Human is a recombinant human RANKL (I140-D317) without any tag, which is produced in E.coli.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $320 In-stock
50 μg $980 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

RANKL (TNFSF11), a type II transmembrane protein, is receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Human is a recombinant human RANKL (I140-D317) without any tag, which is produced in E.coli[1][2].

Background

RANKL (TNFSF11) belongs to TNF family. RANKL is a type II transmembrane protein and is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. RANKL binds to RANK and induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. In bone tissue, RANKL is expressed by osteoblasts, osteocytes and immune cells, especially in osteoblasts and osteocytes[1]. RANKL is also expressed by T cells and increases proliferation and survival of dendritic cells[2].
Human RANKL shares 82.02% and 84.44% common aa identity with mouse and rat respectively. Human RANKL consists of cytoplasmic domain (1-47), helical domain (48-68), and extracellular domain (69-317). The soluble chain (140-317) is released when cleaved by enzymes such as matrix metalloproteinases (MMP3 or 7) and ADAM[1][3].
RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs)[1].

In Vitro

RANKL (human, 0-50 ng/mL, 24 h) stimulates migration of a clear cell RCC cell line, Caki-1[4].
RANKL (human, 24 h) stimulates PAa cell migration and invasion[5].

In Vivo

RANKL (human, 0.4 or 2 mg/kg/day, s.c.) induces high bone turnover and decreases bone volume, density, and strength in C57BL/6J female mice[6].

Biological Activity

The ED50 is 0.15 μg/mL as measured.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O14788 (I140-D317)

Gene ID
Molecular Construction
N-term
RANKL (I140-D317)
Accession # O14788
C-term
Synonyms
rHuRANK L/TNFSF11; TRANCE; CD254
AA Sequence

IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Molecular Weight

Approximately 20 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RANKL/TNFSF11 Protein, Human
Cat. No.:
HY-P7424
Quantity:
MCE Japan Authorized Agent: