REG1A Protein, Rat (HEK293, Fc)
Based on 1 Customer Validation
REG1A Protein serves as an inhibitor of spontaneous calcium carbonate precipitation.REG1A Protein, Rat (HEK293, Fc) is the recombinant rat-derived REG1A protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
REG1A Protein serves as an inhibitor of spontaneous calcium carbonate precipitation.REG1A Protein, Rat (HEK293, Fc) is the recombinant rat-derived REG1A protein, expressed by HEK293 , with C-hFc labeled tag.
Background
REG1A protein appears to function as an inhibitor of spontaneous calcium carbonate precipitation.
Verified Bioactivity
Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.036 μg/mL, corresponding to a specific activity is 965.251 units/mg.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
P10758 (Q22-A165)
-
Molecular Construction
-
N-term
-
REG1A (Q22-A165)
Accession # P10758 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ZC3H12A; MCPIP-1; Zinc Finger CCCH-Type Containing 12A; MCPIP; Regnase-1; Reg1; MCPIP1; Bifunctional Endoribonuclease And Deubiquitinase ZC3H12A; Monocyte Chemotactic Protein-Induced Protein 1; MCP-1 Treatment-Induced Protein; Zinc Finger CCCH Domain-Cont
-
AA Sequence
QEAEEDLPSARITCPEGSNAYSSYCYYFMEDHLSWAEADLFCQNMNSGYLVSVLSQAEGNFLASLIKESGTTAANVWIGLHDPKNNRRWHWSSGSLFLYKSWDTGYPNNSNRGYCVSVTSNSGYKKWRDNSCDAQLSFVCKFKA
-
Molecular Weight
Approximately 40 kDa & 43 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
