REG-3 gamma/REG3G Protein, Human (HEK293, Fc)

REG-3 gamma/REG3G protein is a bactericidal C-type lectin that specifically targets Gram-positive bacteria by binding to the peptidoglycan surface moiety, mediating bacterial killing. It limits bacterial colonization of intestinal epithelial surfaces and limits microbiota-induced adaptive immune responses. REG-3 gamma/REG3G Protein, Human (HEK293, Fc) is the recombinant human-derived REG-3 gamma/REG3G protein, expressed by HEK293 , with C-hFc labeled tag.

REG-3 gamma/REG3G Protein, a bactericidal C-type lectin, acts exclusively against Gram-positive bacteria by binding to surface-exposed carbohydrate moieties of peptidoglycan, thereby mediating bacterial killing. This protein restricts bacterial colonization of the intestinal epithelial surface, consequently limiting the activation of adaptive immune responses by the microbiota. It functions as a hormone in response to various stimuli, including anti-inflammatory signals like IL17A or the gut microbiome. REG-3 gamma/REG3G Protein is secreted by different cell types to activate its receptor EXTL3, leading to the induction of cell-specific signaling pathways. In keratinocytes, it is induced by IL17A and regulates keratinocyte proliferation and differentiation following skin injury while inhibiting skin inflammation by suppressing inflammatory cytokines such as IL6 and TNF. In lung epithelial cells, REG-3 gamma/REG3G Protein is induced by IL22, inhibiting cytokine production and regulating allergic airway inflammation. Additionally, it is induced in the small intestine by an inulin-enriched diet and Lactobacillus gasseri-enriched microbiome, contributing to the improvement of gut barrier function, energy balance, and glucose levels. Moreover, REG-3 gamma/REG3G Protein modulates the composition of the microbiota in duodenal contents. Lastly, it is produced by nociceptors in response to endotoxins and prevents endotoxic death by targeting the kynurenine pathway in microglia.

Human

HEK293

C-hFc

Q6UW15-1 (E27-D175)

130120  [NCBI]

Full Length of Isoform-1 Mature Protein

EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD

Approximately 44-50.0 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 500 mM NaCl, 10% Glycerol, 0.05% Tween 80, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. /biology-dictionary/pc-3-cell.html  [Content Brief]