1. Recombinant Proteins
  2. Others
  3. RGMB Protein, Mouse (HEK293, His)

RGMB Protein, Mouse (HEK293, His)

Cat. No.: HY-P77178
COA Handling Instructions

RGMB, a member of the RGM family, shapes the developing nervous system as a BMP coreceptor. It enhances BMP signaling and modulates neuronal adhesion. RGMB forms homooligomers and interacts with DRGX, BMP2, BMP4, ACVR1, BMPR1A, BMPR1B, and ACVR2B. It also forms a functional complex with NEO1/neogenin, activating downstream signaling via RhoA. RGMB Protein, Mouse (HEK293, His) is the recombinant mouse-derived RGMB protein, expressed by HEK293 , with C-His, C-10*His labeled tag. The total length of RGMB Protein, Mouse (HEK293, His) is 367 a.a., with molecular weight of ~40.2 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $60 In-stock
10 μg $100 In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RGMB, a member of the RGM family, shapes the developing nervous system as a BMP coreceptor. It enhances BMP signaling and modulates neuronal adhesion. RGMB forms homooligomers and interacts with DRGX, BMP2, BMP4, ACVR1, BMPR1A, BMPR1B, and ACVR2B. It also forms a functional complex with NEO1/neogenin, activating downstream signaling via RhoA. RGMB Protein, Mouse (HEK293, His) is the recombinant mouse-derived RGMB protein, expressed by HEK293 , with C-His, C-10*His labeled tag. The total length of RGMB Protein, Mouse (HEK293, His) is 367 a.a., with molecular weight of ~40.2 KDa.

Background

Repulsive guidance molecule B (RGMB), a member of the repulsive guidance molecule (RGM) family, plays a pivotal role in shaping the developing nervous system. Functioning as a bone morphogenetic protein (BMP) coreceptor, RGMB enhances BMP signaling and contributes to the modulation of neuronal adhesion. While potentially inhibiting neurite outgrowth, RGMB forms homooligomers and interacts with DRGX, BMP2, BMP4, as well as BMP type I receptors (ACVR1, BMPR1A, BMPR1B) and BMP type II receptor (ACVR2B). Notably, RGMB forms a functional complex with its receptor NEO1/neogenin, arranged as a heterotetramer with a 2:2 stoichiometry, where RGMB molecules act as staples bringing two NEO1 receptors together without engaging themselves. This arrangement leads to the activation of downstream signaling via RhoA.

Species

Mouse

Source

HEK293

Tag

C-His;C-10*His

Accession

Q7TQ33/NP_848730.2 (G49-C415)

Gene ID

68799  [NCBI]

Molecular Construction
N-term
RGMB (G49-C415)
Accession # Q7TQ33/NP_848730.2
His
C-term
Synonyms
Repulsive guidance molecule B; RGM-B
AA Sequence

GDCQQPTQCRIQKCTTDFVALTAHLNSAADGFDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEVTHDPCNYHSHGGVREHGGGDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKVTIIFKAQHECTDQKVYQAVTDDLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPMSECIDDGQGQVSAILGHSLPHTTSVQAWPGYTLETASTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSC

Molecular Weight

Approximately 40.2 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS, pH 7.4. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RGMB Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RGMB Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77178
Quantity:
MCE Japan Authorized Agent: