RGS5 Protein, Human (His)

RGS5, an adept signal transduction modulator, enhances G protein alpha subunit GTPase activity, promoting their transition to the inactive GDP-bound state. Interacting with G(i)-alpha and G(o)-alpha, it selectively excludes G(s)-alpha, highlighting its precise role in regulating specific G protein subunits and fine-tuning cellular signaling pathways. RGS5 Protein, Human (His) is the recombinant human-derived RGS5 protein, expressed by E. coli , with N-6*His labeled tag. The total length of RGS5 Protein, Human (His) is 181 a.a., with molecular weight of ~25 kDa.

RGS5, a proficient modulator of signal transduction, exerts its inhibitory impact by enhancing the GTPase activity of G protein alpha subunits, facilitating their transition into the inactive GDP-bound state. While it forms associations with G(i)-alpha and G(o)-alpha, its interaction excludes G(s)-alpha. This selective binding underscores its role in precisely regulating the activity of specific G protein subunits, contributing to the fine-tuning of cellular signaling pathways.

Data is not available.

Human

E. coli

N-6*His

O15539 (M1-K181)

8490  [NCBI]

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Approximately 25 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from sterile 50 mM Tris-HCL, 300 mM NaCl, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.