RGS5 Protein, Human (His)
Based on 1 Customer Validation
RGS5, an adept signal transduction modulator, enhances G protein alpha subunit GTPase activity, promoting their transition to the inactive GDP-bound state. Interacting with G(i)-alpha and G(o)-alpha, it selectively excludes G(s)-alpha, highlighting its precise role in regulating specific G protein subunits and fine-tuning cellular signaling pathways. RGS5 Protein, Human (His) is the recombinant human-derived RGS5 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
RGS5, an adept signal transduction modulator, enhances G protein alpha subunit GTPase activity, promoting their transition to the inactive GDP-bound state. Interacting with G(i)-alpha and G(o)-alpha, it selectively excludes G(s)-alpha, highlighting its precise role in regulating specific G protein subunits and fine-tuning cellular signaling pathways. RGS5 Protein, Human (His) is the recombinant human-derived RGS5 protein, expressed by E. coli , with N-6*His labeled tag.
RGS5, a proficient modulator of signal transduction, exerts its inhibitory impact by enhancing the GTPase activity of G protein alpha subunits, facilitating their transition into the inactive GDP-bound state. While it forms associations with G(i)-alpha and G(o)-alpha, its interaction excludes G(s)-alpha. This selective binding underscores its role in precisely regulating the activity of specific G protein subunits, contributing to the fine-tuning of cellular signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O15539 (M1-K181)
-
Molecular Construction
-
N-term
-
6*His
-
RGS5 (M1-K181)
Accession # O15539 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RGS5; MSTP106; Regulator Of G Protein Signaling 5; MSTP129; Regulator Of G-Protein Signaling 5; MST092; Regulator Of G-Protein Signalling 5; MST106; MSTP032; MST129; MSTP092
-
AA Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)