RNASE6 Protein, Human (HEK293, His)

RNASE6 Protein, a pyrimidine-preferring ribonuclease, exhibits potent antibacterial activity against diverse bacteria, including P. aeruginosa, A. baumanii, and E. coli. Its effect is independent of ribonuclease activity, inducing bacterial membrane disruption and Gram-negative bacteria agglutination, emphasizing its bactericidal properties. RNASE6's robust antibacterial activity suggests a potential role in preserving urinary tract sterility. RNASE6 Protein, Human (HEK293, His) is the recombinant human-derived RNASE6 protein, expressed by HEK293 , with C-6*His labeled tag.

The RNASE6 protein, functioning as a ribonuclease, exhibits a distinct preference for the pyrimidines uridine and cytosine. This ribonuclease demonstrates potent antibacterial activity against a broad spectrum of bacteria, including P. aeruginosa, A. baumanii, M. luteus, S. aureus, E. faecalis, E. faecium, S. saprophyticus, and E. coli. Notably, RNASE6's antibacterial effect is independent of its ribonuclease activity. The protein induces bacterial membrane disruption and promotes the agglutination of Gram-negative bacteria, contributing to its bactericidal properties. RNASE6's formidable antibacterial activity suggests its potential role in maintaining urinary tract sterility.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

Q93091 (W24-L150)

6039  [NCBI]

Full Length of Mature Protein

WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL

Approximately 18-25 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 1 mM DTT, 10% Glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.