1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RNASE6 Protein, Human (HEK293, His)

RNASE6 Protein, Human (HEK293, His)

Cat. No.: HY-P71261
Handling Instructions

RNASE6 Protein, a pyrimidine-preferring ribonuclease, exhibits potent antibacterial activity against diverse bacteria, including P. aeruginosa, A. baumanii, and E. coli. Its effect is independent of ribonuclease activity, inducing bacterial membrane disruption and Gram-negative bacteria agglutination, emphasizing its bactericidal properties. RNASE6's robust antibacterial activity suggests a potential role in preserving urinary tract sterility. RNASE6 Protein, Human (HEK293, His) is the recombinant human-derived RNASE6 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of RNASE6 Protein, Human (HEK293, His) is 127 a.a., with molecular weight of ~22.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RNASE6 Protein, a pyrimidine-preferring ribonuclease, exhibits potent antibacterial activity against diverse bacteria, including P. aeruginosa, A. baumanii, and E. coli. Its effect is independent of ribonuclease activity, inducing bacterial membrane disruption and Gram-negative bacteria agglutination, emphasizing its bactericidal properties. RNASE6's robust antibacterial activity suggests a potential role in preserving urinary tract sterility. RNASE6 Protein, Human (HEK293, His) is the recombinant human-derived RNASE6 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of RNASE6 Protein, Human (HEK293, His) is 127 a.a., with molecular weight of ~22.0 kDa.

Background

The RNASE6 protein, functioning as a ribonuclease, exhibits a distinct preference for the pyrimidines uridine and cytosine. This ribonuclease demonstrates potent antibacterial activity against a broad spectrum of bacteria, including P. aeruginosa, A. baumanii, M. luteus, S. aureus, E. faecalis, E. faecium, S. saprophyticus, and E. coli. Notably, RNASE6's antibacterial effect is independent of its ribonuclease activity. The protein induces bacterial membrane disruption and promotes the agglutination of Gram-negative bacteria, contributing to its bactericidal properties. RNASE6's formidable antibacterial activity suggests its potential role in maintaining urinary tract sterility.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q93091 (W24-L150)

Gene ID
Molecular Construction
N-term
RNASE6 (W24-L150)
Accession # Q93091
6*His
C-term
Synonyms
Ribonuclease K6; RNase K6; RNASE6; RNS6
AA Sequence

WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL

Molecular Weight

Approximately 22.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RNASE6 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RNASE6 Protein, Human (HEK293, His)
Cat. No.:
HY-P71261
Quantity:
MCE Japan Authorized Agent: