1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RNASE6 Protein, Human (HEK293, His)

RNASE6 Protein, a pyrimidine-preferring ribonuclease, exhibits potent antibacterial activity against diverse bacteria, including P. aeruginosa, A. baumanii, and E. coli. Its effect is independent of ribonuclease activity, inducing bacterial membrane disruption and Gram-negative bacteria agglutination, emphasizing its bactericidal properties. RNASE6's robust antibacterial activity suggests a potential role in preserving urinary tract sterility. RNASE6 Protein, Human (HEK293, His) is the recombinant human-derived RNASE6 protein, expressed by HEK293 , with C-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

RNASE6 Protein, a pyrimidine-preferring ribonuclease, exhibits potent antibacterial activity against diverse bacteria, including P. aeruginosa, A. baumanii, and E. coli. Its effect is independent of ribonuclease activity, inducing bacterial membrane disruption and Gram-negative bacteria agglutination, emphasizing its bactericidal properties. RNASE6's robust antibacterial activity suggests a potential role in preserving urinary tract sterility. RNASE6 Protein, Human (HEK293, His) is the recombinant human-derived RNASE6 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The RNASE6 protein, functioning as a ribonuclease, exhibits a distinct preference for the pyrimidines uridine and cytosine. This ribonuclease demonstrates potent antibacterial activity against a broad spectrum of bacteria, including P. aeruginosa, A. baumanii, M. luteus, S. aureus, E. faecalis, E. faecium, S. saprophyticus, and E. coli. Notably, RNASE6's antibacterial effect is independent of its ribonuclease activity. The protein induces bacterial membrane disruption and promotes the agglutination of Gram-negative bacteria, contributing to its bactericidal properties. RNASE6's formidable antibacterial activity suggests its potential role in maintaining urinary tract sterility.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q93091 (W24-L150)

Gene ID
Molecular Construction
N-term
RNASE6 (W24-L150)
Accession # Q93091
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Ribonuclease K6; RNase K6; RNASE6; RNS6
AA Sequence

WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL

Predicted Molecular Mass
15.7 kDa
분자량

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 1 mM DTT, 10% Glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류

RNASE6 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

RNASE6 Protein, Human (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
RNASE6 Protein, Human (HEK293, His)
Cat. No.:
HY-P71261
수량:
MCE Japan Authorized Agent: