Copy Link Print Information

RNASE6 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

RNASE6 Protein, a pyrimidine-preferring ribonuclease, exhibits potent antibacterial activity against diverse bacteria, including P. aeruginosa, A. baumanii, and E. coli. Its effect is independent of ribonuclease activity, inducing bacterial membrane disruption and Gram-negative bacteria agglutination, emphasizing its bactericidal properties. RNASE6's robust antibacterial activity suggests a potential role in preserving urinary tract sterility. RNASE6 Protein, Human (HEK293, His) is the recombinant human-derived RNASE6 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • RNASE6 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

RNASE6 Protein, a pyrimidine-preferring ribonuclease, exhibits potent antibacterial activity against diverse bacteria, including P. aeruginosa, A. baumanii, and E. coli. Its effect is independent of ribonuclease activity, inducing bacterial membrane disruption and Gram-negative bacteria agglutination, emphasizing its bactericidal properties. RNASE6's robust antibacterial activity suggests a potential role in preserving urinary tract sterility. RNASE6 Protein, Human (HEK293, His) is the recombinant human-derived RNASE6 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The RNASE6 protein, functioning as a ribonuclease, exhibits a distinct preference for the pyrimidines uridine and cytosine. This ribonuclease demonstrates potent antibacterial activity against a broad spectrum of bacteria, including P. aeruginosa, A. baumanii, M. luteus, S. aureus, E. faecalis, E. faecium, S. saprophyticus, and E. coli. Notably, RNASE6's antibacterial effect is independent of its ribonuclease activity. The protein induces bacterial membrane disruption and promotes the agglutination of Gram-negative bacteria, contributing to its bactericidal properties. RNASE6's formidable antibacterial activity suggests its potential role in maintaining urinary tract sterility.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q93091 (W24-L150)

  • Gene ID
    6039  [NCBI]
  • Molecular Construction
    • N-term
    • RNASE6 (W24-L150)
      Accession # Q93091
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    RNASE6; Ribonuclease, RNase A Family, K6; Prev. RNS6; Testicular Tissue Protein Li 166; RAD1; Ribonuclease A Family Member K6; Ribonuclease K6; Ribonuclease A D1; RNaseK6; Ribonuclease A Family Member 6; RNase K6

  • AA Sequence

    WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL

  • Predicted Molecular Mass

    15.7 kDa

  • Molecular Weight

    Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 1 mM DTT, 10% Glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • RNASE6 Protein, Human (HEK293, His) Product Image
    1/16
  • RNASE6 Protein, Human (HEK293, His) Product Image