ROR1 Protein, Rat (HEK293, His)

ROR1 protein is an important member of the Tyr protein kinase family in the protein kinase superfamily and plays a key role as a tyrosine kinase in cell signaling and regulation. Its classification emphasizes its importance in phosphorylation events and shares conserved features with related kinases. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293 , with C-10*His labeled tag.

The ROR1 Protein is a key member of the protein kinase superfamily, specifically falling under the Tyr protein kinase family within the ROR subfamily. Its classification highlights its pivotal role as a tyrosine kinase, indicating its involvement in cellular signaling and regulation. As part of the protein kinase superfamily, ROR1 likely shares conserved structural and functional features with related kinases, underscoring its significance in phosphorylation events. The designation within the Tyr protein kinase family further emphasizes its specific role among tyrosine kinases, offering insights into its unique enzymatic functions. The study of ROR1 contributes to our understanding of its role in cellular processes related to tyrosine phosphorylation, presenting potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular signaling pathways. Further exploration of ROR1's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ROR1. Immobilized ROR1 at 2 μg/ml can bind Anti-ROR1 antibody, the ED₅₀ of Rat ROR1 protein is 0.168 μg/mL, corresponding to a specific activity is 5.95×10³ units/mg.

• 
  Measured by its binding ability in a functional ROR1. Immobilized ROR1 at 2 μg/mL can bind Anti-ROR1 antibody, the ED₅₀ of Rat ROR1 protein is 0.168 μg/mL, corresponding to a specific activity is 5.95×103 units/mg.

Rat

HEK293

C-10*His

D3ZZ97/EDL97819.1 (Q30-E403)

362550  [NCBI]

Partial

QETELSVSAELVPTSSWNTSSEIDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

60-75 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.