RSPO1/R-spondin-1 Protein, Human (125a.a, HEK293, hFc)

RSPO1 or R-spondin-1 activates the canonical Wnt pathway through ligand binding to the LGR4-6 receptor, forming a complex with phosphorylated LRP6 and Frizzled receptors. This interaction upregulates target gene expression. RSPO1/R-spondin-1 Protein, Human (125a.a, HEK293, hFc) is the recombinant human-derived RSPO1/R-spondin-1 protein, expressed by HEK293, with C-hFc labeled tag.

RSPO1, also known as R-spondin-1, serves as an activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5, or LGR6), the resulting complex associates with phosphorylated LRP6 and frizzled receptors, activated by extracellular Wnt receptors. This interaction triggers the canonical Wnt signaling pathway, leading to an upregulation of target gene expression. Additionally, RSPO1 plays a role in modulating the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by inhibiting ZNRF3, a crucial regulator in the Wnt pathway. Acting as a ligand for frizzled FZD8 and LRP6, RSPO1 also negatively regulates the TGF-beta pathway and has essential functions in ovary determination. Furthermore, RSPO1 regulates Wnt signaling by counteracting DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1. The protein interacts with the extracellular domain of FZD8 and LRP6, forms a complex with RNF43, LGR5, and RSPO1, and binds heparin. RSPO1's interactions with ZNRF3 facilitate the membrane clearance of ZNRF3, contributing to its multifaceted role in Wnt pathway regulation.

Human

HEK293

C-hFc

Q2MKA7-1 (S21-A146)

284654

Full Length of Isoform-1 Mature Protein

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPA

Approximately 46-56 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of 52 mM Tris, 100 mM Glycine, 25 mM Arginine, 150 mM NaCl, pH7.5 with trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.