2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. RSPO1/R-spondin-1 Protein, Human (CHO)

RSPO1/R-spondin-1 is a secreted glycoprotein. RSPO1/R-spondin-1 binds to LGR4/5/6 receptors and ZNRF3/E3 ubiquitin ligases, inhibits Wnt receptor degradation, stabilizes β-catenin and promotes its nuclear translocation, and activates target gene transcription. RSPO1/R-spondin-1 promotes intestinal organoid survival, induces pancreatic β-cell proliferation to improve diabetes, enhances osteogenic differentiation of mesenchymal stem cells to treat osteoporosis, and inhibits bone erosion in arthritis models. RSPO1/R-spondin-1 Protein, Human (CHO) is a recombinant RSPO1/R-spondin-1 protein expressed by HEK293.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
10 μg Get quote
50 μg Get quote
100 μg Get quote

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RSPO1/R-spondin-1 is a secreted glycoprotein. RSPO1/R-spondin-1 binds to LGR4/5/6 receptors and ZNRF3/E3 ubiquitin ligases, inhibits Wnt receptor degradation, stabilizes β-catenin and promotes its nuclear translocation, and activates target gene transcription. RSPO1/R-spondin-1 promotes intestinal organoid survival, induces pancreatic β-cell proliferation to improve diabetes, enhances osteogenic differentiation of mesenchymal stem cells to treat osteoporosis, and inhibits bone erosion in arthritis models. RSPO1/R-spondin-1 Protein, Human (CHO) is a recombinant RSPO1/R-spondin-1 protein expressed by HEK293.
Background

RSPO1/R-spondin-1 belongs to the R-spondin family (including 4 members, RSPO 1-4)[2][4]. RSPO1/R-spondin-1 is a secreted glycoprotein. RSPO1/R-spondin-1 binds to LGR4/5/6 receptors and ZNRF3/E3 ubiquitin ligase, inhibits Wnt receptor degradation, stabilizes β-catenin and promotes its nuclear translocation, and activates target gene transcription[2][4][7]. RSPO1/R-spondin-1 is expressed in intestinal epithelium, pancreatic acini, bone mesenchyme, joint osteoblasts and other tissues[1][5][6][7]. RSPO1/R-spondin-1, Human is highly homologous to RSPO1 in mouse, rat and other species in terms of amino acid sequence and function (such as activating Wnt signaling and promoting tissue regeneration)[5][6]. RSPO1/R-spondin-1, Human is composed of 263 amino acids, contains N-glycosylation modification (such as Asn137 site), and sugar chain structures include sialic acid, N-acetylglucosamine, etc.[4]. RSPO1/R-spondin-1, Human promotes the survival of intestinal organoids, induces pancreatic β-cell proliferation to improve diabetes, enhances the osteogenic differentiation of mesenchymal stem cells to treat osteoporosis, and inhibits bone erosion in arthritis models[2][5][6][7].
Species

Human
Source

CHO
Tag

Tag free
Accession

Q2MKA7-1 (S21-A263)
Gene ID

284654
Molecular Construction
N-term
RSPO1 (S21-A263)
Accession # Q2MKA7-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein
Synonyms
R-spondin-1; Roof plate-specific spondin-1; RSPO1
AA Sequence

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Predicted Molecular Mass
26.7 kDa
Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
Purity

≥ 95%, as determined by reducing SDS-PAGE.
Endotoxin Level

<0.01 EU/μg determined by LAL method.
Documentation
SDS (251 KB)

COA (220 KB)

Handling Instructions (2659 KB)

RSPO1/R-spondin-1 Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RSPO1/R-spondin-1 Protein, Human (CHO)

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RSPO1/R-spondin-1 Protein, Human (CHO)
Cat. No.:
HY-P705671
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (251 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.