RSPO1/R-spondin-1 Protein, Human (CHO)

RSPO1/R-spondin-1 is a secreted glycoprotein. RSPO1/R-spondin-1 binds to LGR4/5/6 receptors and ZNRF3/E3 ubiquitin ligases, inhibits Wnt receptor degradation, stabilizes β-catenin and promotes its nuclear translocation, and activates target gene transcription. RSPO1/R-spondin-1 promotes intestinal organoid survival, induces pancreatic β-cell proliferation to improve diabetes, enhances osteogenic differentiation of mesenchymal stem cells to treat osteoporosis, and inhibits bone erosion in arthritis models. RSPO1/R-spondin-1 Protein, Human (CHO) is a recombinant RSPO1/R-spondin-1 protein expressed by HEK293.

RSPO1/R-spondin-1 belongs to the R-spondin family (including 4 members, RSPO 1-4)^[2][4]. RSPO1/R-spondin-1 is a secreted glycoprotein. RSPO1/R-spondin-1 binds to LGR4/5/6 receptors and ZNRF3/E3 ubiquitin ligase, inhibits Wnt receptor degradation, stabilizes β-catenin and promotes its nuclear translocation, and activates target gene transcription^[2][4][7]. RSPO1/R-spondin-1 is expressed in intestinal epithelium, pancreatic acini, bone mesenchyme, joint osteoblasts and other tissues^[1][5][6][7]. RSPO1/R-spondin-1, Human is highly homologous to RSPO1 in mouse, rat and other species in terms of amino acid sequence and function (such as activating Wnt signaling and promoting tissue regeneration)^[5][6]. RSPO1/R-spondin-1, Human is composed of 263 amino acids, contains N-glycosylation modification (such as Asn137 site), and sugar chain structures include sialic acid, N-acetylglucosamine, etc.^[4]. RSPO1/R-spondin-1, Human promotes the survival of intestinal organoids, induces pancreatic β-cell proliferation to improve diabetes, enhances the osteogenic differentiation of mesenchymal stem cells to treat osteoporosis, and inhibits bone erosion in arthritis models^[2][5][6][7].

Human

CHO

Tag free

Q2MKA7-1 (S21-A263)

284654

Full Length of Isoform-1 Mature Protein

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<0.01 EU/μg determined by LAL method.

• [1]. /biology-dictionary/cho-cell.html  [Content Brief]