RSPO1/R-spondin-1 Protein, Human (HEK293, His-Avi)

RSPO1, or R-spondin-1, activates the canonical Wnt pathway by ligand binding to LGR4-6 receptors, forming a complex with phosphorylated LRP6 and frizzled receptors. This interaction upregulates target gene expression. RSPO1 inhibits ZNRF3, a Wnt regulator, modulating both canonical and non-canonical Wnt pathways. It acts as a ligand for FZD8 and LRP6, negatively regulating the TGF-beta pathway and influencing ovary determination. RSPO1 counteracts DKK1/KREM1-mediated LRP6 internalization and interacts with FZD8, LRP6, RNF43, LGR5, and heparin, contributing to its diverse role in Wnt pathway regulation. RSPO1/R-spondin-1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived RSPO1/R-spondin-1 protein, expressed by HEK293, with C-Avi, C-10*His labeled tag. The total length of RSPO1/R-spondin-1 Protein, Human (HEK293, His-Avi) is 233 a.a., with molecular weight of 30.2 kDa.

RSPO1, also known as R-spondin-1, serves as an activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5, or LGR6), the resulting complex associates with phosphorylated LRP6 and frizzled receptors, activated by extracellular Wnt receptors. This interaction triggers the canonical Wnt signaling pathway, leading to an upregulation of target gene expression. Additionally, RSPO1 plays a role in modulating the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by inhibiting ZNRF3, a crucial regulator in the Wnt pathway. Acting as a ligand for frizzled FZD8 and LRP6, RSPO1 also negatively regulates the TGF-beta pathway and has essential functions in ovary determination. Furthermore, RSPO1 regulates Wnt signaling by counteracting DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1. The protein interacts with the extracellular domain of FZD8 and LRP6, forms a complex with RNF43, LGR5, and RSPO1, and binds heparin. RSPO1's interactions with ZNRF3 facilitate the membrane clearance of ZNRF3, contributing to its multifaceted role in Wnt pathway regulation.

Human

HEK293

C-Avi;C-10*His

Q2MKA7 (R31-A263)

284654  [NCBI]

RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

30.2 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.