1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. RSPO1/R-spondin-1 Protein, Human (HEK293, His-Avi)

RSPO1/R-spondin-1 Protein, Human (HEK293, His-Avi)

Cat. No.: HY-P700443
Handling Instructions Technical Support

RSPO1 or R-spondin-1 activates the canonical Wnt pathway through ligand binding to the LGR4-6 receptor, forming a complex with phosphorylated LRP6 and Frizzled receptors. This interaction upregulates target gene expression. RSPO1/R-spondin-1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived RSPO1/R-spondin-1 protein, expressed by HEK293 , with C-Avi, C-10*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

RSPO1 or R-spondin-1 activates the canonical Wnt pathway through ligand binding to the LGR4-6 receptor, forming a complex with phosphorylated LRP6 and Frizzled receptors. This interaction upregulates target gene expression. RSPO1/R-spondin-1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived RSPO1/R-spondin-1 protein, expressed by HEK293 , with C-Avi, C-10*His labeled tag.

Background

RSPO1, also known as R-spondin-1, serves as an activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5, or LGR6), the resulting complex associates with phosphorylated LRP6 and frizzled receptors, activated by extracellular Wnt receptors. This interaction triggers the canonical Wnt signaling pathway, leading to an upregulation of target gene expression. Additionally, RSPO1 plays a role in modulating the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by inhibiting ZNRF3, a crucial regulator in the Wnt pathway. Acting as a ligand for frizzled FZD8 and LRP6, RSPO1 also negatively regulates the TGF-beta pathway and has essential functions in ovary determination. Furthermore, RSPO1 regulates Wnt signaling by counteracting DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1. The protein interacts with the extracellular domain of FZD8 and LRP6, forms a complex with RNF43, LGR5, and RSPO1, and binds heparin. RSPO1's interactions with ZNRF3 facilitate the membrane clearance of ZNRF3, contributing to its multifaceted role in Wnt pathway regulation.

Species

Human

Source

HEK293

Tag

C-Avi;C-10*His

Accession

Q2MKA7-1 (R31-A263)

Gene ID
Molecular Construction
N-term
RSPO1 (R31-A263)
Accession # Q2MKA7-1
10*His-Avi
C-term
Protein Length

Partial

Synonyms
rHuR-spondin-1/RSPO1; Roof plate-specific spondin-1
AA Sequence

RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Predicted Molecular Mass
30.2 kDa
분자량

Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

RSPO1/R-spondin-1 Protein, Human (HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

RSPO1/R-spondin-1 Protein, Human (HEK293, His-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
RSPO1/R-spondin-1 Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P700443
수량:
MCE Japan Authorized Agent: