RUVBL2 Protein, Human (His-SUMO)

Customer Review

Based on 1 Customer Validation

The RUVBL2 protein has DNA-stimulated ATPase and DNA helicase activities and can hexamerize for ATP hydrolysis. As a member of the NuA4 complex, RUVBL2 contributes to histone acetylation, altering nucleosome-DNA interactions to activate genes. RUVBL2 Protein, Human (His-SUMO) is the recombinant human-derived RUVBL2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The RUVBL2 protein has DNA-stimulated ATPase and DNA helicase activities and can hexamerize for ATP hydrolysis. As a member of the NuA4 complex, RUVBL2 contributes to histone acetylation, altering nucleosome-DNA interactions to activate genes. RUVBL2 Protein, Human (His-SUMO) is the recombinant human-derived RUVBL2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

RUVBL2 protein possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (5' to 3') activity, with hexamerization considered critical for ATP hydrolysis, and adjacent subunits in the ring-like structure contributing to the ATPase activity. As a component of the NuA4 histone acetyltransferase complex, RUVBL2 is involved in the transcriptional activation of select genes, primarily through the acetylation of nucleosomal histones H4 and H2A. This modification may alter nucleosome-DNA interactions and promote interaction of the modified histones with other proteins that positively regulate transcription. The NuA4 complex, including the ATPase and helicase activities, is, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Furthermore, RUVBL2 is a component of a SWR1-like complex responsible for the removal of histone H2A.Z/H2AZ1 from the nucleosome and is proposed as a core component of the chromatin remodeling INO80 complex, which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding. RUVBL2 plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex. Additionally, it may inhibit the transcriptional activity of ATF2 and is involved in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway, negatively regulating expression of ER stress response genes. RUVBL2 may also play a role in regulating the composition of the U5 snRNP complex.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • RUVBL2 (A2-S463)
      Accession # Q9Y230-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    RUVBL2; RuvB-Like 2; RuvB Like AAA ATPase 2; TAP54-Beta; TIP49b; Reptin52; INO80J; Reptin; TIP48; ECP-51; INO80 Complex Subunit J; Erythrocyte Cytosolic Protein, 51-KD; ECP51; RuvB-Like 2 (E. Coli), Isoform CRA_b; RVB2; RuvB-Like 2 (E. Coli), Isoform CRA_

  • AA Sequence

    ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

  • Predicted Molecular Mass

    67 kDa

  • Molecular Weight

    Approximately 67 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00