S100A13 Protein, Human
Based on 1 Customer Validation
The S100A13 protein is critical for unconventional protein export, binding calcium and copper ions without interference. It is essential for copper-dependent stress-induced export of IL1A and FGF1. S100A13 Protein, Human is the recombinant human-derived S100A13 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The S100A13 protein is critical for unconventional protein export, binding calcium and copper ions without interference. It is essential for copper-dependent stress-induced export of IL1A and FGF1. S100A13 Protein, Human is the recombinant human-derived S100A13 protein, expressed by E. coli , with tag free.
S100A13, a versatile protein, plays a pivotal role in the unconventional export of proteins devoid of a signal peptide. This function is orchestrated by its ability to bind two calcium ions per subunit and one copper ion, with the binding of copper not impeding calcium binding. Notably, S100A13 is indispensable for the copper-dependent stress-induced export of IL1A and FGF1. In a calcium-free state, the protein exhibits an affinity for lipid vesicles containing phosphatidylserine, distinguishing its membrane-interaction preferences. Structurally, S100A13 forms homodimers and is a constituent of a copper-dependent multiprotein complex alongside FGF1 and SYT1. These intricate interactions underscore the regulatory role of S100A13 in mediating the export of specific proteins through alternative pathways, contributing to cellular homeostasis. Additionally, the protein engages in direct interactions with IL1A, further expanding its repertoire of molecular partnerships.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q99584 (A2-K98)
-
Molecular Construction
-
N-term
-
S100A13 (A2-K98)
Accession # Q99584 -
C-term
-
-
Protein Length
Partial
-
Synonyms
S100A13; S100 Calcium-Binding Protein A13; S100 Calcium Binding Protein A13; Protein S100-A13
-
AA Sequence
AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
-
Predicted Molecular Mass
11.3 kDa
-
Molecular Weight
Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 1 mM CaCl2, 0.1% Tween-20, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
