S100A13 Protein, Human

Customer Review

Based on 1 Customer Validation

The S100A13 protein is critical for unconventional protein export, binding calcium and copper ions without interference. It is essential for copper-dependent stress-induced export of IL1A and FGF1. S100A13 Protein, Human is the recombinant human-derived S100A13 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The S100A13 protein is critical for unconventional protein export, binding calcium and copper ions without interference. It is essential for copper-dependent stress-induced export of IL1A and FGF1. S100A13 Protein, Human is the recombinant human-derived S100A13 protein, expressed by E. coli , with tag free.

Background

S100A13, a versatile protein, plays a pivotal role in the unconventional export of proteins devoid of a signal peptide. This function is orchestrated by its ability to bind two calcium ions per subunit and one copper ion, with the binding of copper not impeding calcium binding. Notably, S100A13 is indispensable for the copper-dependent stress-induced export of IL1A and FGF1. In a calcium-free state, the protein exhibits an affinity for lipid vesicles containing phosphatidylserine, distinguishing its membrane-interaction preferences. Structurally, S100A13 forms homodimers and is a constituent of a copper-dependent multiprotein complex alongside FGF1 and SYT1. These intricate interactions underscore the regulatory role of S100A13 in mediating the export of specific proteins through alternative pathways, contributing to cellular homeostasis. Additionally, the protein engages in direct interactions with IL1A, further expanding its repertoire of molecular partnerships.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • S100A13 (A2-K98)
      Accession # Q99584
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    S100A13; S100 Calcium-Binding Protein A13; S100 Calcium Binding Protein A13; Protein S100-A13

  • AA Sequence

    AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK

  • Predicted Molecular Mass

    11.3 kDa

  • Molecular Weight

    Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 1 mM CaCl2, 0.1% Tween-20, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00