1. Recombinant Proteins
  2. Others
  3. S100A13 Protein, Human

S100A13 Protein, Human

Cat. No.: HY-P71271
COA Handling Instructions

The S100A13 protein is critical for unconventional protein export, binding calcium and copper ions without interference. It is essential for copper-dependent stress-induced export of IL1A and FGF1. S100A13 Protein, Human is the recombinant human-derived S100A13 protein, expressed by E. coli , with tag free. The total length of S100A13 Protein, Human is 97 a.a., with molecular weight of ~12.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $105 In-stock
50 μg $290 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100A13 protein is critical for unconventional protein export, binding calcium and copper ions without interference. It is essential for copper-dependent stress-induced export of IL1A and FGF1. S100A13 Protein, Human is the recombinant human-derived S100A13 protein, expressed by E. coli , with tag free. The total length of S100A13 Protein, Human is 97 a.a., with molecular weight of ~12.0 kDa.

Background

S100A13, a versatile protein, plays a pivotal role in the unconventional export of proteins devoid of a signal peptide. This function is orchestrated by its ability to bind two calcium ions per subunit and one copper ion, with the binding of copper not impeding calcium binding. Notably, S100A13 is indispensable for the copper-dependent stress-induced export of IL1A and FGF1. In a calcium-free state, the protein exhibits an affinity for lipid vesicles containing phosphatidylserine, distinguishing its membrane-interaction preferences. Structurally, S100A13 forms homodimers and is a constituent of a copper-dependent multiprotein complex alongside FGF1 and SYT1. These intricate interactions underscore the regulatory role of S100A13 in mediating the export of specific proteins through alternative pathways, contributing to cellular homeostasis. Additionally, the protein engages in direct interactions with IL1A, further expanding its repertoire of molecular partnerships.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q99584 (A2-K98)

Gene ID
Molecular Construction
N-term
S100A13 (A2-K98)
Accession # Q99584
C-term
Synonyms
Protein S100-A13; S100A13; S100 calcium-binding protein A13
AA Sequence

AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK

Molecular Weight

Approximately 12.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl, 1mM CaCl2, 0.1% Tween-20, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

S100A13 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A13 Protein, Human
Cat. No.:
HY-P71271
Quantity:
MCE Japan Authorized Agent: