S100A3 Protein, Human (His-MBP)

S100A3 Protein, functioning as a monomer, displays a robust binding affinity for calcium and zinc. It is implicated in calcium-dependent cuticle cell differentiation and contributes to the formation of the hair shaft and hair cuticular barrier. In its citrullinated state, S100A3 can exist as both a homodimer and a homotetramer, indicating potential involvement in various cellular processes associated with these forms. S100A3 Protein, Human (His-MBP) is the recombinant human-derived S100A3 protein, expressed by E. coli , with N-His, N-MBP labeled tag.

S100A3, a protein with the ability to bind both calcium and zinc, emerges as a potential player in calcium-dependent cuticle cell differentiation and the formation of hair shafts and cuticular barriers. Its binding affinity for calcium and zinc suggests a regulatory role in cellular processes dependent on these ions. The protein is known to exist in homodimer and homotetramer forms, particularly in its citrullinated state, indicating a potential structural significance in its functional activity. The implication of S100A3 in processes related to hair development and barrier formation underscores its importance in the molecular mechanisms governing tissue differentiation and integrity.

Human

E. coli

N-His;N-MBP

P33764 (M1-Q101)

6274  [NCBI]

Full Length

MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ

Approximately 50 kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, 20% glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.