1. Recombinant Proteins
  2. Others
  3. S100A7 Protein, Human

S100A7 Protein, Human

Cat. No.: HY-P71274
COA Handling Instructions

The S100A7 protein is known to interact with RANBP9, suggesting a potential functional relationship between the two molecules. However, no details of their interaction are provided in the referenced paragraph. S100A7 Protein, Human is the recombinant human-derived S100A7 protein, expressed by E. coli , with tag free. The total length of S100A7 Protein, Human is 101 a.a., with molecular weight of ~14.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $110 In-stock
50 μg $320 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100A7 protein is known to interact with RANBP9, suggesting a potential functional relationship between the two molecules. However, no details of their interaction are provided in the referenced paragraph. S100A7 Protein, Human is the recombinant human-derived S100A7 protein, expressed by E. coli , with tag free. The total length of S100A7 Protein, Human is 101 a.a., with molecular weight of ~14.0 kDa.

Background

S100A7 protein is known to interact with RANBP9, indicating a potential functional relationship between these two molecules. S100A7 belongs to the S100 family of calcium-binding proteins and has been implicated in various biological processes, including inflammation and cancer. The interaction with RANBP9 suggests a potential role for S100A7 in cellular signaling or protein transport, but further investigation is required to fully understand the functional implications of this interaction.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P31151 (M1-Q101)

Gene ID
Molecular Construction
N-term
S100A7 (M1-Q101)
Accession # P31151
C-term
Synonyms
Protein S100-A7; Psoriasin; S100 calcium-binding protein A7; S100A7; PSOR1; S100A7C
AA Sequence

MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

S100A7 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A7 Protein, Human
Cat. No.:
HY-P71274
Quantity:
MCE Japan Authorized Agent: