S100A7 Protein, Human
Based on 1 Customer Validation
The S100A7 protein is known to interact with RANBP9, suggesting a potential functional relationship between the two molecules. S100A7 Protein, Human is the recombinant human-derived S100A7 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The S100A7 protein is known to interact with RANBP9, suggesting a potential functional relationship between the two molecules. S100A7 Protein, Human is the recombinant human-derived S100A7 protein, expressed by E. coli , with tag free.
Background
S100A7 protein is known to interact with RANBP9, indicating a potential functional relationship between these two molecules. S100A7 belongs to the S100 family of calcium-binding proteins and has been implicated in various biological processes, including inflammation and cancer. The interaction with RANBP9 suggests a potential role for S100A7 in cellular signaling or protein transport, but further investigation is required to fully understand the functional implications of this interaction.
Verified Bioactivity
Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells. The ED50 for this effect is 2.355 μg/mL, corresponding to a specific activity is 424.628 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P31151 (M1-Q101)
-
Molecular Construction
-
N-term
-
S100A7 (M1-Q101)
Accession # P31151 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A7; S100 Calcium Binding Protein A7 (Psoriasin 1); Prev. PSOR1; Psoriasin 1; S100A7c; Psoriasin; Protein S100-A7; S100A7C; S100 Calcium-Binding Protein A7 (Psoriasin 1); S100 Calcium Binding Protein A7; S100 Calcium-Binding Protein A7
-
AA Sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 2 mM CaCl2, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
