Copy Link Print Information

S100A8 Protein, Mouse (sf9, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

S100A8 protein plays crucial roles in the immune system and inflammation.It activates NADPH-oxidase, generating reactive oxygen species in immune cells.Additionally, S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers the essential cofactor arachidonic acid to the complex.S100A8 Protein, Mouse (sf9, His) is the recombinant mouse-derived S100A8 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for S100A8 Protein, Mouse (sf9, His)
  • Experimental Validation Results for S100A8 Protein, Mouse (sf9, His)
  • S100A8 Protein, Mouse (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

S100A8 protein plays crucial roles in the immune system and inflammation.It activates NADPH-oxidase, generating reactive oxygen species in immune cells.Additionally, S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers the essential cofactor arachidonic acid to the complex.S100A8 Protein, Mouse (sf9, His) is the recombinant mouse-derived S100A8 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

S100A8 is a protein that plays multiple roles in the immune system and inflammatory processes. It activates the enzyme NADPH-oxidase, which is involved in producing reactive oxygen species (ROS) in immune cells. S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers an essential cofactor called arachidonic acid to the complex.

Verified Bioactivity

Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 3.345 μg/mL, corresponding to a specific activity is 298.9537 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 3.345 μg/mL, corresponding to a specific activity is 298.9537 U/mg.

Technical Parameters

  • Species Mouse
  • Source Sf9 insect cells
  • Tag C-His
  • Accession

    P27005 (M1-E89)

  • Gene ID
    20201  [NCBI]
  • Molecular Construction
    • N-term
    • S100A8 (M1-E89)
      Accession # P27005
    • His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    S100A8; MRP-8; Prev. CAGA; Urinary Stone Protein Band A; Prev. CFAG; Protein S100-A8; MRP8; Calgranulin A; P8; S100 Calcium-Binding Protein A8; Migration Inhibitory Factor-Related Protein 8; Calgranulin-A; Leukocyte L1 Complex Light Chain; CP-10; Calprote

  • AA Sequence

    MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE

  • Molecular Weight

    Approximately 11-14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, pH 8.0, 10 % glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 3.345 μg/mL, corresponding to a specific activity is 298.9537 U/mg.

  • S100A8 Protein, Mouse (sf9, His) Product Image
    1/16
  • Experimental Validation Results for S100A8 Protein, Mouse (sf9, His)
  • Experimental Validation Results for S100A8 Protein, Mouse (sf9, His)
  • S100A8 Protein, Mouse (sf9, His) Product Image