1. Recombinant Proteins
  2. Others
  3. S100A8 Protein, Mouse (sf9, His)

S100A8 Protein, Mouse (sf9, His)

Cat. No.: HY-P73671
COA Handling Instructions

S100A8 protein plays crucial roles in the immune system and inflammation. It activates NADPH-oxidase, generating reactive oxygen species in immune cells. Additionally, S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers the essential cofactor arachidonic acid to the complex. S100A8 Protein, Mouse (sf9, His) is the recombinant mouse-derived S100A8 protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of S100A8 Protein, Mouse (sf9, His) is 89 a.a., with molecular weight of ~11.7 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $85 In-stock
50 μg $230 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A8 protein plays crucial roles in the immune system and inflammation. It activates NADPH-oxidase, generating reactive oxygen species in immune cells. Additionally, S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers the essential cofactor arachidonic acid to the complex. S100A8 Protein, Mouse (sf9, His) is the recombinant mouse-derived S100A8 protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of S100A8 Protein, Mouse (sf9, His) is 89 a.a., with molecular weight of ~11.7 kDa.

Background

S100A8 is a protein that plays multiple roles in the immune system and inflammatory processes. It activates the enzyme NADPH-oxidase, which is involved in producing reactive oxygen species (ROS) in immune cells. S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers an essential cofactor called arachidonic acid to the complex.

Species

Mouse

Source

Sf9 insect cells

Tag

C-His

Accession

P27005 (M1-E89)

Gene ID

20201  [NCBI]

Molecular Construction
N-term
S100A8 (M1-E89)
Accession # P27005
His
C-term
Synonyms
Protein S100-A8; Calgranulin-A; MRP-8; S100a8; Caga
AA Sequence

MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE

Molecular Weight

Approximately 11.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, pH 8.0, 10 % glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

S100A8 Protein, Mouse (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A8 Protein, Mouse (sf9, His)
Cat. No.:
HY-P73671
Quantity:
MCE Japan Authorized Agent: