1. Recombinant Proteins
  2. Others
  3. S100B Protein, Human (His)

S100B Protein, Human (His)

Cat. No.: HY-P70659
COA Handling Instructions

The S100B protein binds calcium and zinc ions, each with a different site on the monomer. Physiological levels of potassium ions disrupt the binding of calcium and zinc, affecting high-affinity sites. S100B Protein, Human (His) is the recombinant human-derived S100B protein, expressed by E. coli , with N-6*His labeled tag. The total length of S100B Protein, Human (His) is 92 a.a., with molecular weight of ~12.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg $40 In-stock
10 μg $60 In-stock
50 μg $160 In-stock
100 μg $250 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100B protein binds calcium and zinc ions, each with a different site on the monomer. Physiological levels of potassium ions disrupt the binding of calcium and zinc, affecting high-affinity sites. S100B Protein, Human (His) is the recombinant human-derived S100B protein, expressed by E. coli , with N-6*His labeled tag. The total length of S100B Protein, Human (His) is 92 a.a., with molecular weight of ~12.0 kDa.

Background

S100B is a protein that plays a role in binding calcium and zinc ions. It has distinct binding sites for each ion on each monomer. Physiological concentrations of potassium ions can interfere with the binding of both calcium and zinc, particularly affecting the high-affinity calcium-binding sites. S100B functions as a neurotrophic factor, promoting astrocytosis and axonal proliferation. It is also involved in the innervation of thermogenic adipose tissue, promoting sympathetic innervation. S100B can activate the STK38 kinase by releasing inhibitory interactions within the kinase. After a myocardial infarction, it interacts with AGER, potentially contributing to myocyte apoptosis through ERK1/2 and p53/TP53 signaling. S100B may assist in the cytoplasmic processing of ATAD3A, preventing aggregation and facilitating mitochondrial localization. It can also modulate the activity of other proteins, such as TPR-containing proteins, through calcium-dependent interactions. S100B forms dimers of either two alpha chains, two beta chains, or one alpha and one beta chain. It interacts with various proteins, including CACYBP, ATAD3A, S100A6, CAPZA1, AGER, PPP5C, TPPP, and isoform CLSTN3beta of CLSTN3, with different functional consequences.

Biological Activity

Measured in a cell proliferation assay using THP-1 cells. The ED50 for this effect is 0.09308 μg/mL, corresponding to a specific activity is 1.07×104 units/mg.

  • Measured in a cell proliferation assay using THP-1 cells. The ED50 for this effect is 0.09308 μg/mL, corresponding to a specific activity is 1.07×104 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P04271 (M1-E92)

Gene ID
Molecular Construction
N-term
6*His
S100B (M1-E92)
Accession # P04271
C-term
Synonyms
Protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; S100b; S100 beta; S100 calcium binding protein B
AA Sequence

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Molecular Weight

Approximately 12.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

S100B Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100B Protein, Human (His)
Cat. No.:
HY-P70659
Quantity:
MCE Japan Authorized Agent: