S100P Protein, Human (His, solution)
Based on 1 Customer Validation
The S100P protein is a multifunctional calcium sensor that actively contributes to cellular calcium signaling. It interacts calcium-dependently with proteins such as EZR and PPP5C, indirectly affecting processes such as microvilli formation. S100P Protein, Human (His, solution) is the recombinant human-derived S100P protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The S100P protein is a multifunctional calcium sensor that actively contributes to cellular calcium signaling. It interacts calcium-dependently with proteins such as EZR and PPP5C, indirectly affecting processes such as microvilli formation. S100P Protein, Human (His, solution) is the recombinant human-derived S100P protein, expressed by E. coli , with N-6*His labeled tag.
Background
The S100P Protein exhibits a multifaceted role as a calcium sensor, actively contributing to cellular calcium signaling. In a calcium-dependent manner, it engages in interactions with various proteins, including EZR and PPP5C, thereby indirectly participating in physiological processes such as the formation of microvilli in epithelial cells. Notably, S100P may stimulate cell proliferation through autocrine activation of the receptor for activated glycation end products (RAGE). Existing as a homodimer and forming heterodimers with S100A1, S100P also interacts with S100PBP and S100Z, and in a calcium-dependent manner, associates with CACYBP. The dimeric form of S100P binds to and activates EZR/Ezrin by revealing its F-actin binding sites, while its calcium-dependent interaction with PPP5C modulates PPP5C activity, providing further insight into the diverse regulatory roles of S100P in cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P25815 (M1-K95)
-
Molecular Construction
-
N-term
-
6*His
-
S100P (M1-K95)
Accession # P25815 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100P; Protein S100-P; S100 Calcium Binding Protein P; Protein S100-E; Migration-Inducing Gene 9 Protein; MIG9; S100 Calcium-Binding Protein P; S100E
-
AA Sequence
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
-
Predicted Molecular Mass
12.6 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 1 mM DTT, 0.1 M NaCl, 20% glycerol, pH 8.0 .
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)