S100P Protein, Human (His)

The S100P protein is a multifunctional calcium sensor that actively contributes to cellular calcium signaling. It interacts calcium-dependently with proteins such as EZR and PPP5C, indirectly affecting processes such as microvilli formation. S100P Protein, Human (His) is the recombinant human-derived S100P protein, expressed by E. coli , with N-6*His labeled tag. The total length of S100P Protein, Human (His) is 95 a.a., with molecular weight of ~12.0 kDa.

The S100P Protein exhibits a multifaceted role as a calcium sensor, actively contributing to cellular calcium signaling. In a calcium-dependent manner, it engages in interactions with various proteins, including EZR and PPP5C, thereby indirectly participating in physiological processes such as the formation of microvilli in epithelial cells. Notably, S100P may stimulate cell proliferation through autocrine activation of the receptor for activated glycation end products (RAGE). Existing as a homodimer and forming heterodimers with S100A1, S100P also interacts with S100PBP and S100Z, and in a calcium-dependent manner, associates with CACYBP. The dimeric form of S100P binds to and activates EZR/Ezrin by revealing its F-actin binding sites, while its calcium-dependent interaction with PPP5C modulates PPP5C activity, providing further insight into the diverse regulatory roles of S100P in cellular processes.

Human

E. coli

N-6*His

P25815 (M1-K95)

6286  [NCBI]

MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Approximately 12.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 1 mM DTT, 0.1 M NaCl, 20% Glycerol, pH 8.0 .

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.