SAA1 Protein, Human (His)

Cat. No.: HY-P70510: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

SAA1 Protein, a major acute phase protein, forms a homohexamer comprising dimers of trimers. While the native form doesn't spontaneously form amyloid fibrils, partial proteolysis can induce amyloid fibril generation. SAA1 also serves as an apolipoprotein in the HDL complex and shows affinity for heparin. SAA1 Protein, Human (His) is the recombinant human-derived SAA1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service Protein Expression Service

Size	Stock	Quantity
Free Sample	Apply now
5 μg	In-stock	Estimated Time of Arrival: December 31
10 μg	In-stock	Estimated Time of Arrival: December 31
50 μg	In-stock	Estimated Time of Arrival: December 31
100 μg	In-stock	Estimated Time of Arrival: December 31
> 100 μg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

1 Publications Citing Use of MCE SAA1 Protein, Human (His)

•J Exp Clin Cancer Res. 2025 Sep 30;44(1):277. [Abstract]

Others

Flow Cytometry

RT-PCR

: SAA1 Protein, Human (His) purchased from MCE. Usage Cited in: J Exp Clin Cancer Res. 2025 Sep 30;44(1):277. [Abstract]; Rescue experiments assessing the effect of adding recombinant SAA1 protein (HY-P70510; 200 ng/ml; ; 20–24 h) or the TLR2/4 inhibitor SsnB (Sparstolonin B; HY-116213; 20 µM; 20–24 h) on the ability of A2780 cell supernatants to recruit MDSCs.

: SAA1 Protein, Human (His) purchased from MCE. Usage Cited in: J Exp Clin Cancer Res. 2025 Sep 30;44(1):277. [Abstract]; Rescue experiments assessing the effect of adding recombinant SAA1 protein (HY-P70510; 200 ng/ml; ; 20–24 h) or the TLR2/4 inhibitor SsnB (Sparstolonin B; HY-116213; 20 µM; 20–24 h) on the ability of A2780 cell supernatants to recruit MDSCs.

: SAA1 Protein, Human (His) purchased from MCE. Usage Cited in: J Exp Clin Cancer Res. 2025 Sep 30;44(1):277. [Abstract]; Rescue experiments assessing the effect of adding recombinant SAA1 protein (HY-P70510; 200 ng/ml; ; 20–24 h) or the TLR2/4 inhibitor SsnB (Sparstolonin B; HY-116213; 20 µM; 20–24 h) on the ability of A2780 cell supernatants to induce GMP differentiation into MDSCs. Data are presented as mean ± SEM from three independent experiments; one-way ANOVA followed by Tukey’s multiple comparisons test.

: SAA1 Protein, Human (His) purchased from MCE. Usage Cited in: J Exp Clin Cancer Res. 2025 Sep 30;44(1):277. [Abstract]; IL-1β expression and secretion in MDSCs after adding the TLR2/4 inhibitor SsnB (Sparstolonin B; HY-116213; 20 µM; 20–24 h) to SAA1 (HY-P70510; 200 ng/ml; ; 20–24 h) treatment, detected by qRT-PCR (left) and ELISA (right). Data are presented as mean ± SEM from three independent experiments; one-way ANOVA followed by Dunnett’s multiple comparisons test.

Biological Activity
Technical Parameters
Properties
Documentation

Description	SAA1 Protein, a major acute phase protein, forms a homohexamer comprising dimers of trimers. While the native form doesn't spontaneously form amyloid fibrils, partial proteolysis can induce amyloid fibril generation. SAA1 also serves as an apolipoprotein in the HDL complex and shows affinity for heparin. SAA1 Protein, Human (His) is the recombinant human-derived SAA1 protein, expressed by E. coli , with N-6*His labeled tag.
Background	SAA1 protein, a major acute phase protein, exists as a homohexamer composed of dimers of trimers. While the native, undenatured form does not spontaneously form amyloid fibrils, partial proteolysis can lead to the generation of amyloid fibrils. Additionally, SAA1 functions as an apolipoprotein within the HDL complex and exhibits an affinity for heparin.
Biological Activity	Measured by its ability to chemoattract THP-1 cells. The ED₅₀ for this effect is <100 ng/mL. Measured by its ability to chemoattract THP-1 cells. The ED₅₀ for this effect is 53.85 ng/mL, corresponding to a specific activity is 1.857×10^4 U/mg.
Species	Human
Source	E. coli
Tag	N-6*His
Accession	AAH07022.1 (R19-Y122)
Gene ID	6288 [NCBI]
Molecular Construction	N-term 6*His SAA1 (R19-Y122) Accession # AAH07022.1 C-term
Protein Length	Partial
Synonyms	Serum Amyloid A-1 Protein; SAA; SAA1
AA Sequence	RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY
Molecular Weight	Approximately 13.0 kDa
Purity	≥ 95%, as determined by reducing SDS-PAGE.
Appearance	Lyophilized powder
Formulation	1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl,1 mM EDTA, pH 8.0. 2.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4. Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Storage & Stability	Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping	Room temperature in continental US; may vary elsewhere.
Documentation	Select Batch: Data Sheet (235 KB) SDS (251 KB) COA (220 KB) Handling Instructions (2659 KB)