1. Recombinant Proteins
  2. Others
  3. SAA1 Protein, Human (His)

SAA1 Protein, Human (His)

Cat. No.: HY-P70510
COA Handling Instructions

SAA1 Protein, a major acute phase protein, forms a homohexamer comprising dimers of trimers. While the native form doesn't spontaneously form amyloid fibrils, partial proteolysis can induce amyloid fibril generation. SAA1 also serves as an apolipoprotein in the HDL complex and shows affinity for heparin. SAA1 Protein, Human (His) is the recombinant human-derived SAA1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SAA1 Protein, Human (His) is 104 a.a., with molecular weight of ~14.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $170 In-stock
50 μg $510 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SAA1 Protein, a major acute phase protein, forms a homohexamer comprising dimers of trimers. While the native form doesn't spontaneously form amyloid fibrils, partial proteolysis can induce amyloid fibril generation. SAA1 also serves as an apolipoprotein in the HDL complex and shows affinity for heparin. SAA1 Protein, Human (His) is the recombinant human-derived SAA1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SAA1 Protein, Human (His) is 104 a.a., with molecular weight of ~14.0 kDa.

Background

SAA1 protein, a major acute phase protein, exists as a homohexamer composed of dimers of trimers. While the native, undenatured form does not spontaneously form amyloid fibrils, partial proteolysis can lead to the generation of amyloid fibrils. Additionally, SAA1 functions as an apolipoprotein within the HDL complex and exhibits an affinity for heparin.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

AAH07022.1 (R19-Y122)

Gene ID
Molecular Construction
N-term
6*His
SAA1 (R19-Y122)
Accession # AAH07022.1
C-term
Synonyms
Serum Amyloid A-1 Protein; SAA; SAA1
AA Sequence

RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl,1 mM EDTA, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SAA1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SAA1 Protein, Human (His)
Cat. No.:
HY-P70510
Quantity:
MCE Japan Authorized Agent: