SAA1 Protein, Human (His)

SAA1 Protein, a major acute phase protein, forms a homohexamer comprising dimers of trimers. While the native form doesn't spontaneously form amyloid fibrils, partial proteolysis can induce amyloid fibril generation. SAA1 also serves as an apolipoprotein in the HDL complex and shows affinity for heparin. SAA1 Protein, Human (His) is the recombinant human-derived SAA1 protein, expressed by E. coli , with N-6*His labeled tag.

SAA1 protein, a major acute phase protein, exists as a homohexamer composed of dimers of trimers. While the native, undenatured form does not spontaneously form amyloid fibrils, partial proteolysis can lead to the generation of amyloid fibrils. Additionally, SAA1 functions as an apolipoprotein within the HDL complex and exhibits an affinity for heparin.

Measured by its ability to chemoattract THP-1 cells. The ED₅₀ for this effect is <100 ng/mL.

• 
  Measured by its ability to chemoattract THP-1 cells. The ED₅₀ for this effect is 53.85 ng/mL, corresponding to a specific activity is 1.857×10^4 U/mg.

Human

E. coli

N-6*His

AAH07022.1 (R19-Y122)

6288  [NCBI]

Partial

RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY

Approximately 13.0 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl,1 mM EDTA, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.