SARS-CoV-2 S glycoprotein (G476S, HEK293, His)
SARS-CoV-2 S glycoprotein (G476S, HEK 293, His) is a SARS-CoV-2 S glycoprotein G476S protein with a His-flag. Variations at G476S alters the ACE2 binding affinity. G476S variants display reduced affinity to ACE2 in comparison to the Wuhan SARS-CoV2 spike protein.
- Species: Virus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
SARS-CoV-2 S glycoprotein (G476S, HEK 293, His) is a SARS-CoV-2 S glycoprotein G476S protein with a His-flag. Variations at G476S alters the ACE2 binding affinity. G476S variants display reduced affinity to ACE2 in comparison to the Wuhan SARS-CoV2 spike protein[1].
Background
SARS-CoV-2, causes the global pandemic coronavirus disease 2019 (Covid-19). SARS-CoV-2 belongs to a family of viruses known as coronaviruse. SARS-CoV-2 is the third human coronavirus this century known to cause pneumonia with a significant case-fatality rate. SARS-CoV-2 is comprised of four structural proteins: Spike protein (S protein), Envelope protein (E), Membrane protein (M), and Nucleocapsid protein (N). D614G does not alter S protein synthesis, processing, or incorporation into SARS-CoV-2 particles, but D614G affinity for ACE2 is reduced due to a faster dissociation rate[2][3].
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag C-10*His
-
Accession
P0DTC2 (R319-F541, G476S)
-
Molecular Construction
-
N-term
-
S glycoprotein (R319-F541, G476S)
Accession # P0DTC2 -
10*His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
E2 Peplomer protein
-
AA Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQASSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
-
Predicted Molecular Mass
27.9 kDa
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
