1. Recombinant Proteins
  2. Viral Proteins
  3. SARS-CoV-2 Proteins
  4. SARS-CoV-2 Spike Proteins
  5. SARS-CoV-2 S Protein
  6. SARS-CoV-2 S glycoprotein (V483A, HEK293, His)

SARS-CoV-2 S glycoprotein (V483A, HEK293, His)

Cat. No.: HY-P72042
Handling Instructions Technical Support

SARS-CoV-2 S glycoprotein (V483A, HEK 293, His) is a recombinant protein expressed in HEK 293 cells with a His tag. S glycoprotein plays an important role in the evolution and transmission of SARS-CoV-2.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

SARS-CoV-2 S glycoprotein (V483A, HEK 293, His) is a recombinant protein expressed in HEK 293 cells with a His tag. S glycoprotein plays an important role in the evolution and transmission of SARS-CoV-2.

Background

The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry[1][2]. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry[1][2]. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry[1][2]. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry[1][2].

Species

Virus

Source

HEK293

Tag

C-10*His

Accession

P0DTC2 (R319-F541, V483A )

Gene ID
Molecular Construction
N-term
S glycoprotein (R319-F541, V483A )
Accession # P0DTC2
10*His
C-term
Protein Length

Partial

Synonyms
E2 Peplomer protein
AA Sequence

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Predicted Molecular Mass
27.8 kDa
Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

SARS-CoV-2 S glycoprotein (V483A, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

SARS-CoV-2 S glycoprotein (V483A, HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
SARS-CoV-2 S glycoprotein (V483A, HEK293, His)
Cat. No.:
HY-P72042
수량:
MCE Japan Authorized Agent: