1. Recombinant Proteins
  2. Viral Proteins
  3. SARS-CoV-2 Proteins
  4. SARS-CoV-2 Spike Proteins
  5. SARS-CoV-2 S Protein
  6. SARS-CoV-2 S glycoprotein (V483A, HEK 293, His)

SARS-CoV-2 S glycoprotein (V483A, HEK 293, His)

Cat. No.: HY-P72042
Handling Instructions

SARS-CoV-2 S glycoprotein (V483A, HEK 293, His) is a recombinant protein expressed in HEK 293 cells with a His tag. S glycoprotein plays an important role in the evolution and transmission of SARS-CoV-2.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
20 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

SARS-CoV-2 S glycoprotein (V483A, HEK 293, His) is a recombinant protein expressed in HEK 293 cells with a His tag. S glycoprotein plays an important role in the evolution and transmission of SARS-CoV-2.

Background

The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry[1][2]. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry[1][2]. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry[1][2]. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry[1][2].

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD at 5 μg/mL can bind human ACE2 , the EC50 is 196.4-272.1 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD at 2 μg/mL can bind
Species

Virus

Source

HEK293

Tag

C-10*His

Accession

P0DTC2 (R319-F541,V483A )

Gene ID
Synonyms
E2 Peplomer protein
AA Sequence

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Molecular Weight

Approximately 27.8 kDa

Purity

Greater than 90% as determined by SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

SARS-CoV-2 S glycoprotein (V483A, HEK 293, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SARS-CoV-2 S glycoprotein (V483A, HEK 293, His)
Cat. No.:
HY-P72042
Quantity:
MCE Japan Authorized Agent: