SARS-CoV-2 S glycoprotein (V483A, HEK293, His)
SARS-CoV-2 S glycoprotein (V483A, HEK 293, His) is a recombinant protein expressed in HEK 293 cells with a His tag. S glycoprotein plays an important role in the evolution and transmission of SARS-CoV-2.
- Species: Virus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
SARS-CoV-2 S glycoprotein (V483A, HEK 293, His) is a recombinant protein expressed in HEK 293 cells with a His tag. S glycoprotein plays an important role in the evolution and transmission of SARS-CoV-2.
Background
The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry[1][2]. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry[1][2]. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry[1][2]. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry[1][2].
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag C-10*His
-
Accession
P0DTC2 (R319-F541, V483A)
-
Molecular Construction
-
N-term
-
S glycoprotein (R319-F541, V483A)
Accession # P0DTC2 -
10*His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
E2 Peplomer protein
-
AA Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
-
Predicted Molecular Mass
27.8 kDa
-
Molecular Weight
Approximately 33-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
References
[1]. Shen S, et al. Expression, glycosylation, and modification of the spike (S) glycoprotein of SARS CoV. Methods Mol Biol. 2007;379:127-135. [Content Brief]
[2]. Wang S, et al. AXL is a candidate receptor for SARS-CoV-2 that promotes infection of pulmonary and bronchial epithelial cells. Cell Res. 2021;31(2):126-140. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
