SARS-CoV-2 S protein RBD-SD1 (HEK293, His)
SARS-CoV-2 S protein RBD-SD1 (HEK293, His) produced in HEK293 cells is a recombinant 2019-nCoV S protein receptor-binding domain (RBD) to conserved subdomains SD1 fragment with His tag.
- Species: Virus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
SARS-CoV-2 S protein RBD-SD1 (HEK293, His) produced in HEK293 cells is a recombinant 2019-nCoV S protein receptor-binding domain (RBD) to conserved subdomains SD1 fragment with His tag[1][2].
Background
The transmembrane CoV S-protein spike trimer of 2019-nCoV is composed of interwoven protomers that include an N-terminal receptor-binding S1 subunit and a C-terminal S2 subunit that contains the fusion elements. The S1 subunit is subdivided into the N-terminal domain (NTD) followed by the receptor-binding domain (RBD) and two structurally conserved subdomains (SD1 and SD2).
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag C-6*His
-
Accession
QHD43416.1 (R319-S591)
-
Molecular Construction
-
N-term
-
Spike RBD-SD1 (R319-S591)
Accession # QHD43416.1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
2019-nCov RBD Protein; 2019-nCoV Spike RBD Protein; S protein RBD; 2019-nCoV S protein RBD
-
AA Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCS
-
Predicted Molecular Mass
31.4 kDa
-
Molecular Weight
Approximately 35-43 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Renhong Yan, et al. Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science. 2020 Mar 27; 367(6485): 1444–1448. [Content Brief]
[2]. Rory Henderson, et al. Controlling the SARS-CoV-2 Spike Glycoprotein Conformation. bioRxiv. 2020 May 18;2020.05.18.102087. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
