SBDS Protein, Mouse (His)
Based on 1 Customer Validation
SBDS proteins are essential for the assembly of mature ribosomes and ribosome biogenesis. It cooperates with EFL1 to catalyze the GTP-dependent release of EIF6 from 60S preribosomes in the cytoplasm, activating the translation ability of ribosomes. SBDS Protein, Mouse (His) is the recombinant mouse-derived SBDS protein, expressed by E. coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
SBDS proteins are essential for the assembly of mature ribosomes and ribosome biogenesis. It cooperates with EFL1 to catalyze the GTP-dependent release of EIF6 from 60S preribosomes in the cytoplasm, activating the translation ability of ribosomes. SBDS Protein, Mouse (His) is the recombinant mouse-derived SBDS protein, expressed by E. coli , with N-His labeled tag.
SBDS is an indispensable factor in the assembly of mature ribosomes and the intricate process of ribosome biogenesis. Collaborating with EFL1, it orchestrates the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence. This function involves facilitating the assembly of 80S ribosomes and ensuring EIF6 recycling to the nucleus, where it is vital for 60S rRNA processing and nuclear export. SBDS is crucial for maintaining normal levels of protein synthesis and may contribute to cellular stress resistance, DNA damage response, and cell proliferation. The protein forms associations with the 60S ribosomal subunit and interacts with key partners such as NPM1, RPA1, and PRKDC. It is also part of a complex comprising the 60S ribosomal subunit, SBDS, and EFL1. Furthermore, SBDS may engage in interactions with NIP7 and CLN3, underscoring its multifaceted role in cellular processes.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His
-
Accession
P70122 (M1-E250)
-
Molecular Construction
-
N-term
-
His
-
SBDS (M1-E250)
Accession # P70122 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SBDS; SDS; SBDS Ribosome Maturation Factor; SBDS, Ribosome Assembly Guanine Nucleotide Exchange Factor; Ribosome Maturation Protein SBDS; FLJ10917; CGI-97; Shwachman-Bodian-Diamond Syndrome Isoform 3; SDO1; Shwachman-Bodian-Diamond Syndrome Protein; SWDS;
-
AA Sequence
MSIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGRGSLEVLSLKDVEEGDEKFE
-
Molecular Weight
Approximately 30 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
