Copy Link Print Information

SCF Protein, Human

5 Cited Publications
Customer Review

Based on 5 publication(s) in Google Scholar

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. SCF Protein, Human is the recombinant human-derived SCF protein, expressed in E. coli.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for SCF Protein, Human
  • Experimental Validation Results for SCF Protein, Human
  • Experimental Validation Results for SCF Protein, Human
  • Experimental Validation Results for SCF Protein, Human
  • SCF Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. SCF Protein, Human is the recombinant human-derived SCF protein, expressed in E. coli.

Background

Stem cell factor (SCF) also known as mast cell growth factor (MGF) and steel-factor (SLF), plays essential roles in gametogenesis, melanogenesis and early stages of hematopoiesis. SCF is a dimeric molecule that exerts its biological functions by binding to and activating the receptor tyrosine kinase c-Kit[1][2].

In Vitro

SCF Protein, Human (0-110 ng/mL, 7-42 days) is the ligand for c-kit proto-oncogene that can promote the proliferation and differentiation of early hematopoietic progenitor cells, as well as the growth and differentiation of various cell types. SCF Protein, Human promotes the differentiation of human fetal liver cells into mast cells[3].
SCF Protein, Human (0-100 ng/mL, 72 h) increases the viability of human erythroleukemia cell TF-1 and prevents cell death[4].

Verified Bioactivity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1-5 ng/mL, corresponding to a specific activity is > 2×105 units/mg.

Results
  • Experimental Validation Results for SCF Protein, Human
    Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.194 ng/mL, corresponding to a specific activity is 8.38×105 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P21583-1 (E26-A189)

  • Gene ID
    4254  [NCBI]
  • Molecular Construction
    • N-term
    • SCF (E26-A189)
      Accession # P21583-1
    • C-term
  • Protein Length

    Full Length of Soluble KIT ligand

  • Synonyms

    Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF

  • AA Sequence

    EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

  • Predicted Molecular Mass

    18.6 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for SCF Protein, Human
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.0.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Dehbashi M, Kamali E, Vallian S. Comparative genomics of human stem cell factor (SCF). Mol Biol Res Commun. 2017;6(1):1-11. [Content Brief]

[2]. Lennartsson J, Rönnstrand L. Stem cell factor receptor/c-Kit: from basic science to clinical implications. Physiol Rev. 2012;92(4):1619-1649. [Content Brief]

[3]. Irani A M, et al. Recombinant human stem cell factor stimulates differentiation of mast cells from dispersed human fetal liver cells[J]. 1992.

[4]. Akuta T, et al., Expression of bioactive soluble human stem cell factor (SCF) from recombinant Escherichia coli by coproduction of thioredoxin and efficient purification using arginine in affinity chromatography. Protein Expr Purif. 2015 Jan;105:1-7. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.194 ng/mL, corresponding to a specific activity is 8.38×105 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.194 ng/mL, corresponding to a specific activity is 8.38×105 units/mg.

  • 1/16

    SCF Protein, Human purchased from MedChemExpress. Usage Cited in: Int Forum Allergy Rhinol. 2025 Aug;15(8):837-850. [Abstract]

    Customer Validation
     SCF (100 ng/mL; 1 h). P65 and ERK activation in mast cells under the same conditions was determined via western blotting.

  • 1/16

    SCF Protein, Human purchased from MedChemExpress. Usage Cited in: Int Forum Allergy Rhinol. 2025 Aug;15(8):837-850. [Abstract]

    Customer Validation
     The mRNA expression levels of IL‐4 was quantified via a real‐time quantitative polymerase chain reaction (qPCR) assay in mast cells that were stimulated with IL‐33 (10 ng/mL, 6 h) following pretreatment with stem cell factor (SCF; 100 ng/mL, 1 h).

  • SCF Protein, Human Product Image
    1/16
  • Experimental Validation Results for SCF Protein, Human
  • Experimental Validation Results for SCF Protein, Human
  • Experimental Validation Results for SCF Protein, Human
  • Experimental Validation Results for SCF Protein, Human
  • SCF Protein, Human Product Image