SCF Protein, Human

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. SCF Protein, Human is the recombinant human-derived SCF protein, expressed in E. coli.

Stem cell factor (SCF) also known as mast cell growth factor (MGF) and steel-factor (SLF), plays essential roles in gametogenesis, melanogenesis and early stages of hematopoiesis. SCF is a dimeric molecule that exerts its biological functions by binding to and activating the receptor tyrosine kinase c-Kit^[1][2].

SCF Protein, Human (0-110 ng/mL, 7-42 days) is the ligand for c-kit proto-oncogene that can promote the proliferation and differentiation of early hematopoietic progenitor cells, as well as the growth and differentiation of various cell types. SCF Protein, Human promotes the differentiation of human fetal liver cells into mast cells^[3].
SCF Protein, Human (0-100 ng/mL, 72 h) increases the viability of human erythroleukemia cell TF-1 and prevents cell death^[4].

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 1-5 ng/mL, corresponding to a specific activity is > 2×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 1.194 ng/mL, corresponding to a specific activity is 8.38×10⁵ units/mg.

Human

E. coli

Tag Free

P21583-1 (E26-A189)

4254  [NCBI]

Full Length of Soluble KIT ligand

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.0.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Dehbashi M, Kamali E, Vallian S. Comparative genomics of human stem cell factor (SCF). Mol Biol Res Commun. 2017;6(1):1-11.  [Content Brief]

  [2]. Lennartsson J, Rönnstrand L. Stem cell factor receptor/c-Kit: from basic science to clinical implications. Physiol Rev. 2012;92(4):1619-1649.  [Content Brief]

  [3]. Irani A M, et al. Recombinant human stem cell factor stimulates differentiation of mast cells from dispersed human fetal liver cells[J]. 1992.

  [4]. Akuta T, et al., Expression of bioactive soluble human stem cell factor (SCF) from recombinant Escherichia coli by coproduction of thioredoxin and efficient purification using arginine in affinity chromatography. Protein Expr Purif. 2015 Jan;105:1-7.  [Content Brief]