SCF Protein, Mouse (P.pastoris)

SCF Protein, Mouse (P.pastoris) is the ligand for the receptor-type protein-tyrosine kinase KIT. It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis.

Embryo implantation is a complex process that requires the interaction of embryo and endometrium. Several growth factors and cytokines appear to be involved in this process. Stem cell factor (SCF) and its receptor c-kit regulate the proliferation and survival of germ cells and play an important role in follicular development. During embryonic development, SCF and c-kit are essential for the survival and proliferation of the germ cell and migration toward the gonad. c-kit mRNA is expressed in the primordial germ cells, while the SCF transcript is expressed along their migratory pathway toward the genital ridge^[1].

The ED₅₀ is <10.0 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of >1.0× 10⁵ units/mg.

Mouse

P. pastoris

Tag Free

P20826 (K26-A189)

17311  [NCBI]

MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Approximately 18.4 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 50 mM Tris, pH 8.0.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Mitsunari M, et al. The potential role of stem cell factor and its receptor c-kit in the mouse blastocyst implantation. Mol Hum Reprod. 1999 Sep;5(9):874-9.  [Content Brief]