1. Recombinant Proteins
  2. SCF Protein, Mouse (P.pastoris)

SCF Protein, Mouse (P.pastoris)

Cat. No.: HY-P7064
Handling Instructions

SCF Protein, Mouse (P.pastoris) is the ligand for the receptor-type protein-tyrosine kinase KIT. It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
2 μg $70 In-stock
Estimated Time of Arrival: December 31
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $270 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuSCF; Hematopoietic growth factor KL; MGF; Mast Cell Growth Factor
Species

Mouse

Source

P. pastoris

Accession

P20826 (K26-A189)

Gene ID

17311

Molecular Weight

Approximately 18.4 kDa

AA Sequence

MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Biological Activity
The ED50 is <10.0 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of >1.0× 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 50 mM Tris, pH 8.0.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Embryo implantation is a complex process that requires the interaction of embryo and endometrium. Several growth factors and cytokines appear to be involved in this process. Stem cell factor (SCF) and its receptor c-kit regulate the proliferation and survival of germ cells and play an important role in follicular development. During embryonic development, SCF and c-kit are essential for the survival and proliferation of the germ cell and migration toward the gonad. c-kit mRNA is expressed in the primordial germ cells, while the SCF transcript is expressed along their migratory pathway toward the genital ridge[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SCF Protein, Mouse (P.pastoris)
Cat. No.:
HY-P7064
Quantity:
MCE Japan Authorized Agent: