SCF Protein, Rat (HEK293)

SCF Protein, Rat (HEK293) is a hematopoietic cytokine, triggered by binding to its ligand c-kit, and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis.

Stem Cell Factor is a hematopoietic cytokine, triggered by binding to its ligand c-kit, and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis. Stem Cell Factor (SCF) is applied for hematopoietic stem cell mobilization, exvivo stem/progenitor cell expansion, gene therapy, and immunotherapy^[1]. Stem Cell Factor regulates cell survival, proliferation, differentiation, and migration in divergent cell types^[2].

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 6.967-50 ng/mL, corresponding to a specific activity is >20000 units/mg.

• 
  Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 6.967 ng/mL, corresponding to a specific activity is 1.44×10⁵ units/mg.

Rat

HEK293

Tag Free

P21581 (Q26-A189)

60427  [NCBI]

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

10-24 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Farhadi B, et al. Construction of pPIC9 Recombinant Vector Containing Human Stem Cell Factor. Adv Pharm Bull. 2013;3(2):303-8.  [Content Brief]

  [2]. Kim JY, et al. Stem cell factor is a potent endothelial permeability factor. Arterioscler Thromb Vasc Biol. 2014 Jul;34(7):1459-67.  [Content Brief]