1. Recombinant Proteins
  2. Others
  3. SCG3/Secretogranin-3 Protein, Human (HEK293, His, solution)

SCG3/Secretogranin-3 Protein, Human (HEK293, His, solution)

Cat. No.: HY-P74568
Handling Instructions Technical Support

SCG3, a granin protein, regulates secretory granule formation and acts as a sorting receptor for intragranular proteins like CHGA. It interacts with SCG2 and CHGA, coordinating cellular processes. SCG3 also interacts with CPE, implying involvement in diverse cellular functions and regulatory pathways. Moreover, it may facilitate angiogenesis by promoting endothelial cell proliferation, migration, and tube formation via the MEK/ERK pathway. SCG3/Secretogranin-3 Protein, Human (HEK293, His, solution) is the recombinant human-derived SCG3/Secretogranin-3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SCG3, a granin protein, regulates secretory granule formation and acts as a sorting receptor for intragranular proteins like CHGA. It interacts with SCG2 and CHGA, coordinating cellular processes. SCG3 also interacts with CPE, implying involvement in diverse cellular functions and regulatory pathways. Moreover, it may facilitate angiogenesis by promoting endothelial cell proliferation, migration, and tube formation via the MEK/ERK pathway. SCG3/Secretogranin-3 Protein, Human (HEK293, His, solution) is the recombinant human-derived SCG3/Secretogranin-3 protein, expressed by HEK293 , with C-His labeled tag.

Background

Secretogranin-3 (SCG3), a member of the granin protein family, actively regulates the biogenesis of secretory granules, acting as a sorting receptor for intragranular proteins, including chromogranin A (CHGA). Beyond its role in granule formation, SCG3 may participate in angiogenesis, exerting effects on endothelial cells by promoting proliferation, migration, and tube formation through the MEK/ERK signaling pathway. The protein interacts with CHGA and secretogranin II (SCG2), contributing to the orchestration of cellular processes. Additionally, SCG3 forms interactions, specifically through its C-terminus, with Carboxypeptidase E (CPE), suggesting a potential involvement in various cellular functions and regulatory pathways.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q8WXD2-1 (F20-L468)

Gene ID
Molecular Construction
N-term
SCG3 (F20-L468)
Accession # Q8WXD2-1
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Secretogranin-3; Secretogranin III; SgIII; SCG3
AA Sequence

FPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL

Molecular Weight

54-63 kDa

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SCG3/Secretogranin-3 Protein, Human (HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SCG3/Secretogranin-3 Protein, Human (HEK293, His, solution)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SCG3/Secretogranin-3 Protein, Human (HEK293, His, solution)
Cat. No.:
HY-P74568
Quantity:
MCE Japan Authorized Agent: