SENP8 Protein, Human (His)
SENP8 protein, a pivotal protease in the NEDD8 pathway, plays a dual role in catalyzing the processing of full-length NEDD8 into its mature form and facilitating the deconjugation of NEDD8 from specific target proteins, including cullins and p53. SENP8's dual functionality underscores its crucial role in regulating NEDD8 modification, impacting various cellular pathways and functions. SENP8 Protein, Human (His) is the recombinant human-derived SENP8 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SENP8 protein, a pivotal protease in the NEDD8 pathway, plays a dual role in catalyzing the processing of full-length NEDD8 into its mature form and facilitating the deconjugation of NEDD8 from specific target proteins, including cullins and p53. SENP8's dual functionality underscores its crucial role in regulating NEDD8 modification, impacting various cellular pathways and functions. SENP8 Protein, Human (His) is the recombinant human-derived SENP8 protein, expressed by E. coli , with N-6*His labeled tag.
Background
SENP8 protein serves as a pivotal protease in the NEDD8 pathway, playing a dual role by catalyzing the processing of full-length NEDD8 into its mature form and facilitating the deconjugation of NEDD8 from specific target proteins, including cullins and p53. This dual functionality underscores SENP8's crucial involvement in regulating NEDD8 modification, a process that has profound implications for various cellular pathways and functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q96LD8 (M1-K212)
-
Molecular Construction
-
N-term
-
6*His
-
SENP8 (M1-K212)
Accession # Q96LD8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SENP8; Sentrin-Specific Protease 8; Prev. PRSC2; Deneddylase 1; NEDP1; HsT17512; DEN1; SUMO/Sentrin Specific Protease Family Member 8; NEDD8-Specific Protease 1; SUMO Sentrin Specific Protease Family Member 8; SUMO/Sentrin Peptidase Family Member, NEDD8 S
-
AA Sequence
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK
-
Predicted Molecular Mass
26.2 kDa
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
