SH2D1A Protein, Human (His)

Customer Review

Based on 1 Customer Validation

SH2D1A protein regulates receptors of the SLAM family (SLAMF1, CD244, LY9, CD84, SLAMF6, and SLAMF7). SH2D1A Protein, Human (His) is the recombinant human-derived SH2D1A protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SH2D1A protein regulates receptors of the SLAM family (SLAMF1, CD244, LY9, CD84, SLAMF6, and SLAMF7). SH2D1A Protein, Human (His) is the recombinant human-derived SH2D1A protein, expressed by E. coli , with N-6*His labeled tag.

Background

SH2D1A Protein, a cytoplasmic adapter, intricately orchestrates signaling receptors within the signaling lymphocytic activation molecule (SLAM) family, including SLAMF1, CD244, LY9, CD84, SLAMF6, and SLAMF7. Functionally collaborating with SH2D1B/EAT-2 in SLAM signaling, it was initially proposed that SH2D1A's association with SLAMF1 prevents its binding to inhibitory effectors such as INPP5D/SHIP1 and PTPN11/SHP-2. Contrary to this, simultaneous interactions lead to the recruitment of FYN, triggering the phosphorylation and activation of SLAMF1. SH2D1A plays a pivotal role in positively regulating CD244/2B4- and CD84-mediated natural killer (NK) cell functions and can also enhance NK cell activation mediated by CD48, SLAMF6, LY9, and SLAMF7. In the context of NK cell-mediated cytotoxicity, SH2D1A augments conjugate formation with target cells. Beyond its role in NK cells, SH2D1A may extend its influence to the regulation of neurotrophin receptors NTRK1, NTRK2, and NTRK3, as evidenced by its interactions with these receptors. Additionally, SH2D1A interacts with CD84, CD244, LY9, SLAMF1, and FYN, showcasing its versatile involvement in intricate cellular signaling networks.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • SH2D1A (M1-P128)
      Accession # O60880
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    SH2D1A; SLAM-Associated Protein; Prev. IMD5; Signaling Lymphocyte Activation Molecule-Associated Protein; Prev. LYP; SLAM Associated Protein/SH2 Domain Protein 1A; DSHP; T Cell Signal Transduction Molecule SAP; SAP; T-Cell Signal Transduction Molecule SAP

  • AA Sequence

    MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

  • Predicted Molecular Mass

    16.4 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00