1. Recombinant Proteins
  2. Others
  3. SH2D1A Protein, Human (His)

SH2D1A Protein, Human (His)

Cat. No.: HY-P71038
COA Handling Instructions

SH2D1A protein regulates receptors of the SLAM family (SLAMF1, CD244, LY9, CD84, SLAMF6, and SLAMF7). SH2D1A Protein, Human (His) is the recombinant human-derived SH2D1A protein, expressed by E. coli , with N-6*His labeled tag. The total length of SH2D1A Protein, Human (His) is 128 a.a., with molecular weight of ~16.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $89 In-stock
50 μg $250 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SH2D1A protein regulates receptors of the SLAM family (SLAMF1, CD244, LY9, CD84, SLAMF6, and SLAMF7). SH2D1A Protein, Human (His) is the recombinant human-derived SH2D1A protein, expressed by E. coli , with N-6*His labeled tag. The total length of SH2D1A Protein, Human (His) is 128 a.a., with molecular weight of ~16.0 kDa.

Background

SH2D1A Protein, a cytoplasmic adapter, intricately orchestrates signaling receptors within the signaling lymphocytic activation molecule (SLAM) family, including SLAMF1, CD244, LY9, CD84, SLAMF6, and SLAMF7. Functionally collaborating with SH2D1B/EAT-2 in SLAM signaling, it was initially proposed that SH2D1A's association with SLAMF1 prevents its binding to inhibitory effectors such as INPP5D/SHIP1 and PTPN11/SHP-2. Contrary to this, simultaneous interactions lead to the recruitment of FYN, triggering the phosphorylation and activation of SLAMF1. SH2D1A plays a pivotal role in positively regulating CD244/2B4- and CD84-mediated natural killer (NK) cell functions and can also enhance NK cell activation mediated by CD48, SLAMF6, LY9, and SLAMF7. In the context of NK cell-mediated cytotoxicity, SH2D1A augments conjugate formation with target cells. Beyond its role in NK cells, SH2D1A may extend its influence to the regulation of neurotrophin receptors NTRK1, NTRK2, and NTRK3, as evidenced by its interactions with these receptors. Additionally, SH2D1A interacts with CD84, CD244, LY9, SLAMF1, and FYN, showcasing its versatile involvement in intricate cellular signaling networks.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O60880 (M1-P128)

Gene ID
Molecular Construction
N-term
6*His
SH2D1A (M1-P128)
Accession # O60880
C-term
Synonyms
SH2 Domain-Containing Protein 1A; Duncan Disease SH2-Protein; Signaling Lymphocytic Activation Molecule-Associated Protein; SLAM-Associated Protein; T-Cell Signal Transduction Molecule SAP; SH2D1A; DSHP; SAP
AA Sequence

MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SH2D1A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SH2D1A Protein, Human (His)
Cat. No.:
HY-P71038
Quantity:
MCE Japan Authorized Agent: