SHH Protein, Human (C24II)

SHH Protein, Human (C24II) is a recombinant human sonic hedgehog variant. SHH Protein is a secreted signal transducer responsible not only for patterning of the anterior–posterior axis during early limb and neuronal development, but also for generating cell-type diversity at later developmental stages.

Sonic Hedgehog (SHH) is a secreted factor. The protein is heavily modified through cleavage and posttranslational modification and its release from producing cells can also be modulated by interactions with Dispatched, Scube2, and heparan sulfate proteoglycan^[1][2].

Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 (CCL-226) mouse embryonic fibroblast cells. The ED50 for this effect is <2 μg/mL, corresponding to a specific activity is 7.513×10^3 units/mg.

• 
  Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 13.31 ng/mL, corresponding to a specific activity is 7.513×10³ units/mg.

Human

E. coli

Tag Free

Q15465 (G25-G197, C24II)

6469  [NCBI]

IIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Approximately 22.44 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Garcia ADR, et al. The Elegance of Sonic Hedgehog: Emerging Novel Functions for a Classic Morphogen. J Neurosci. 2018 Oct 31;38(44):9338-9345.  [Content Brief]

  [2]. Gomes DC, et al. Sonic hedgehog signaling is active in human adrenal cortex development and deregulated in adrenocortical tumors. J Clin Endocrinol Metab. 2014 Jul;99(7):E1209-16.  [Content Brief]