1. Recombinant Proteins
  2. Others
  3. SHH Protein, Mouse (CHO)

SHH Protein, Mouse (CHO)

Cat. No.: HY-P7288
Handling Instructions

SHH Protein, Mouse (CHO) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $490 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

SHH Protein, Mouse (CHO) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

CHO

Tag

Tag Free

Accession

Q62226 (C25-G198)

Gene ID

20423

Synonyms
rMuShh; HHG-1; ShhNC
AA Sequence

CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Weight

Approximately 20 kDa

Biological Activity
The ED50 is <1 μg/mL as measured by CCL-226 cells, corresponding to a specific activity of >1.0 × 103 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Sonic hedgehog (Shh) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation[1]. Sonic hedgehog (Shh) plays a critical role in post-natal skeletal muscle regeneration. Sonic hedgehog (Shh) is a crucial morphogen that regulates epithelial-mesenchymal interactions during embryogenesis. In adults, the Shh pathway has been shown to be up-regulated following skeletal muscle and myocardium ischemia, suggesting that the embryonic Shh pathway can be recruited[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SHH Protein, Mouse (CHO)
Cat. No.:
HY-P7288
Quantity:
MCE Japan Authorized Agent: