Siglec-10 Protein, Mouse (HEK293, Fc)

Siglec-10 protein is an adhesion molecule that mediates sialic acid-dependent cell binding, preferentially selecting α-2,3- or α-2,6-linked sialic acid. Its sialic acid recognition site may be masked through cis interactions. Siglec-10 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Siglec-10 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Siglec-10 Protein, Mouse (HEK293, Fc) is 525 a.a., with molecular weight of 110-135 kDa.

Siglec-10 Protein, identified as a putative adhesion molecule, serves as a mediator of sialic-acid-dependent binding to cells, with a preference for alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may undergo masking through cis interactions with sialic acids on the same cell surface. In the immune response, Siglec-10 functions as an inhibitory receptor, achieving ligand-induced tyrosine phosphorylation and recruiting cytoplasmic phosphatases via their SH2 domains to block signal transduction through the dephosphorylation of signaling molecules. Notably, it participates in the negative regulation of B-cell antigen receptor signaling, specifically acting on B1 cells to inhibit Ca(2+) signaling, cellular expansion, and antibody secretion. This inhibition is dependent on PTPN6/SHP-1. Siglec-10, in association with CD24, may be involved in selectively suppressing the immune response to danger-associated molecular patterns (DAMPs) and regulating the immune response of natural killer (NK) cells. Furthermore, it plays a role in controlling autoimmunity and, during the initiation of adaptive immune responses by CD8-alpha(+) dendritic cells, inhibits cross-presentation by impairing the formation of MHC class I-peptide complexes. Additionally, in the context of microbial infection by RNA viruses, Siglec-10 inhibits RIG-I signaling in macrophages by promoting its CBL-dependent ubiquitination and degradation via PTPN11/SHP-2. The multifaceted roles of Siglec-10 highlight its intricate involvement in diverse cellular processes and immune modulation.

Mouse

HEK293

C-hFc

Q80ZE3 (M19-K543)

243958  [NCBI]

MESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTTSVLLLPDKDSATAFSK

110-135 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.