Siglec-15 Protein, Human (Biotinylated, HEK293, His-Avi)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

The Siglec-15 Protein plays a crucial role in cellular interactions by selectively binding to sialylated glycoproteins, indicating a specific affinity for molecules with sialic acid residues. Additionally, Siglec-15 engages in molecular associations with TYROBP and HCST, suggesting its involvement in intricate signaling pathways. This ability to interact with key signaling partners underscores Siglec-15's potential significance in mediating immune responses and cellular communication. The specific recognition of sialylated glycoproteins highlights the protein's role in recognizing and responding to cell surface modifications, contributing to the complex network of cellular interactions.

Immobilized Mouse Human chimeric MAb (5G12 Human IgG1) at 5 μg/mL (100 μL/well) can bind Biotinylated Human Siglec-15 His-Avi with a linear range of 0.2-3 ng/mL.

Human

HEK293

C-Avi;C-His

Q6ZMC9-1 (F20-T263)

284266  [NCBI]

Extracellular Domain

Biotin

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

33-43 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of 25 mM MES,150 mM NaCl, pH5.5. Normally trehalose is added as protectant before lyophilization.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/cho-cell.html  [Content Brief]