1. Recombinant Proteins
  2. Receptor Proteins Biotinylated Proteins
  3. Siglec
  4. Siglec-15
  5. Siglec-15 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Siglec-15 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P70767
SDS COA Handling Instructions

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

Background

The Siglec-15 Protein plays a crucial role in cellular interactions by selectively binding to sialylated glycoproteins, indicating a specific affinity for molecules with sialic acid residues. Additionally, Siglec-15 engages in molecular associations with TYROBP and HCST, suggesting its involvement in intricate signaling pathways. This ability to interact with key signaling partners underscores Siglec-15's potential significance in mediating immune responses and cellular communication. The specific recognition of sialylated glycoproteins highlights the protein's role in recognizing and responding to cell surface modifications, contributing to the complex network of cellular interactions.

Species

Human

Source

HEK293

Tag

C-Avi;C-hFc

Accession

Q6ZMC9-1 (F20-T263)

Gene ID
Molecular Construction
N-term
Siglec-15 (F20-T263)
Accession # Q6ZMC9-1
hFc-Avi
C-term
Synonyms
Sialic acid-binding Ig-like lectin 15; Siglec-15; CD33 antigen-like 3; CD33L3
AA Sequence

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Weight

58-75 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 150 mM NaCl, 0.3% Chaps, 5% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Siglec-15 Protein, Human (Biotinylated, HEK293, Fc-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Siglec-15 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P70767
Quantity:
MCE Japan Authorized Agent: