1. Recombinant Proteins
  2. Receptor Proteins Biotinylated Proteins
  3. Siglec
  4. Siglec-15
  5. Siglec-15 Protein, Mouse (Biotinylated, HEK293, His)

Siglec-15 Protein, Mouse (Biotinylated, HEK293, His)

Cat. No.: HY-P78208
Handling Instructions Technical Support

Siglec-15 Protein, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis, inhibiting antigen-specific T cell responses in vitro and in vivo. Siglec-15 Protein, Mouse (Biotinylated, HEK293, His) is the recombinant mouse-derived Siglec-15 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Siglec-15 Protein, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis, inhibiting antigen-specific T cell responses in vitro and in vivo. Siglec-15 Protein, Mouse (Biotinylated, HEK293, His) is the recombinant mouse-derived Siglec-15 protein, expressed by HEK293 , with C-His labeled tag.

Background

Siglec-15, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 acts upstream of or within regulation of actin cytoskeleton organization. Siglec-15 deficiency can promote bone formation and reduce bone resorption, indicating that Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis and may serve as a target to inhibit bone resorption and promote bone remodeling that increases bone mass. Siglec-15 is a predominantly macrophage-mediated suppressor of T cell responses. In tumors, Siglec-15 is negatively regulated by IFN-γ, thus influencing effector T cell-mediated antitumor immunity. Genetic ablation or antibody blockade of Siglec-15 amplifies anti-tumor immunity in the TME and inhibits tumor growth in some mouse models. Siglec-15 as a potential target for normalization cancer immunotherapy[1][2][3][4].

Species

Mouse

Source

HEK293

Tag

C-8*His

Accession

A7E1W8 (R24-T262)

Gene ID
Molecular Construction
N-term
Siglec-15 (R24-T262)
Accession # A7E1W8
8*His
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
CD33 molecule-like 3; CD33L3; HsT1361; Siglec15; CD33 antigen-like 3; SIGLEC-15
AA Sequence

RRDASGDLLNTEAHSAPAQRWSMQVPAEVNAEAGDAAVLPCTFTHPHRHYDGPLTAIWRSGEPYAGPQVFRCTAAPGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADSGRYFCRVEFTGDAHDRYESRHGVRLRVTAAAPRIVNISVLPGPAHAFRALCTAEGEPPPALAWSGPAPGNSSAALQGQGHGYQVTAELPALTRDGRYTCTAANSLGRAEASVYLFRFHGAPGTST

Predicted Molecular Mass
26.7 kDa
Molecular Weight

Approximately 35-43 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

Siglec-15 Protein, Mouse (Biotinylated, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Siglec-15 Protein, Mouse (Biotinylated, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Siglec-15 Protein, Mouse (Biotinylated, HEK293, His)
Cat. No.:
HY-P78208
Quantity:
MCE Japan Authorized Agent: