SIRP gamma Protein, Cynomolgus (HEK293, Fc)

SIRP gamma Protein, a member of signal-regulatory protein (SIRP) family, is the only SIRP detected on T cells and activated NK cells. SIRP gamma can bind CD47, providing T cells and NK cells with a cell surface molecule capable of interacting with CD47. SIRP gamma-CD47 interaction mediates strong cell-cell adhesion and supports T cell-APC contact, enhancing antigen presentation and consequent T-cell proliferation and cytokine secretion. SIRP gamma Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived SIRP gamma protein, expressed by HEK293 , with C-hFc labeled tag.

SIRP gamma (SIRPG), a member of signal-regulatory protein (SIRP) family, is the only SIRP detected on T cells and activated NK cells. It emerges as a immunoglobulin-like cell surface receptor, demonstrating its role in mediating cell-cell adhesion upon binding with CD47. This interaction is pivotal in enhancing antigen-specific T-cell proliferation and providing costimulatory signals for T-cell activation. As a result, SIRP gamma engages with CD47 on antigen-presenting cells, highlighting its involvement in modulating immune responses. SIRP gamma-CD47 interaction mediates strong cell-cell adhesion and supports T cell-APC contact, enhancing antigen presentation and consequent T-cell proliferation and cytokine secretion^[1].

Cynomolgus

HEK293

C-hFc

XP_028684116 (E29-H360)

716034  [NCBI]

Partial

EEELQMIQPEKLLLVAVGESATLNCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADAGTYYCVKFRKGSPENVEFKSGPGTEMALRAKPSAPVVSGPAARATPEHTVSFTCKSHGFSPRDITLKWFKNGNELSDFQTNVDPAGQSVSYSIRSTARVVLAPWDVRSQVTCEVAHVTLQGDPLRGTANLSEAIRVPPTLEVTQQPIRAGNQVNITYQVRNFYPQNLQLTWLENGNVCRTETASTLTENKDGTYNWTSWLLVNTSDQRDDVVLTCQVKHDGQLAVNKSLVLEVSAHQKDQSSDATH

Approximately 69-79 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.