SLAMF2/CD48 Protein, Human (HEK293, hFc)

SLAMF2/CD48 protein is a GPI-anchored glycoprotein that regulates immune cell function by interacting with CD2 and CD244. SLAMF2/CD48 Protein, Human (HEK293, hFc) is the recombinant human-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-hFc labeled tag.

The SLAMF2/CD48 Protein, a glycosylphosphatidylinositol (GPI)-anchored cell surface glycoprotein, plays a pivotal role in immune cell regulation and activation by interacting through its N-terminal immunoglobulin domain with cell surface receptors, such as 2B4/CD244 or CD2. In T-cell signaling transduction, SLAMF2 associates with CD2, facilitating the efficient recruitment of the Src family protein kinase LCK and LAT to the TCR/CD3 complex, thereby promoting LCK phosphorylation and subsequent activation. Furthermore, SLAMF2 induces the phosphorylation of the cytoplasmic immunoreceptor tyrosine switch motifs (ITSMs) of CD244, initiating a cascade of signaling events that culminate in the formation of the immunological synapse and the directed release of cytolytic granules containing perforin and granzymes by T-lymphocytes and NK-cells. Notably, SLAMF2 interacts directly with CD2, CD244, and LCK, highlighting its intricate involvement in immune cell function and signaling pathways.

Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 μg/mL can bind Anti-CD48 rabbit monoclonal antibody, the EC₅₀ of human CD48 protein is 0.7847-1.107 ng/mL.

Human

HEK293

C-hFc

P09326 (Q27-S220)

962  [NCBI]

Full Length of Mature Protein

QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

Approximately 66 kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.