SLAMF2/CD48 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.
Background
SLAMF2, also known as CD48, is a glycosylphosphatidylinositol (GPI)-anchored cell surface glycoprotein that plays a crucial role in immune cell regulation. Through its N-terminal immunoglobulin domain, SLAMF2 interacts with cell surface receptors, such as 2B4/CD244 or CD2, to modulate immune cell function and activation. In T-cell signaling transduction, SLAMF2 forms complexes with CD2, facilitating the recruitment of the Src family protein kinase LCK and LAT to the TCR/CD3 complex. This interaction leads to the phosphorylation and subsequent activation of LCK. Additionally, SLAMF2 induces the phosphorylation of the cytoplasmic immunoreceptor tyrosine switch motifs (ITSMs) of CD244, initiating signaling events that culminate in the formation of the immunological synapse and the targeted release of cytolytic granules containing perforin and granzymes by T-lymphocytes and NK-cells. SLAMF2 establishes direct interactions with CD2, CD244, and LCK, contributing to its regulatory role in immune responses.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized 2B4/CD244 at 5μg/mL (100μL/well) can bind Rat SLAMF2. The ED50 for this effect is 2.78 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
P10252 (F23-R216)
-
Molecular Construction
-
N-term
-
CD48 (F23-R216)
Accession # P10252 -
His
-
C-term
-
-
Protein Length
Full Length of CD48 antigen Chain
-
Synonyms
CD48; MCD48; Prev. BCM1; CD48 Antigen (B-Cell Membrane Protein); SLAMF2; B-Lymphocyte Activation Marker BLAST-1; Signaling Lymphocytic Activation Molecule 2; Leukocyte Antigen MEM-102; BCM1 Surface Antigen; BLAST1; SLAM Family Member 2; TCT.1; CD48 Antige
-
AA Sequence
FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR
-
Molecular Weight
Approximately 38-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
