1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Platelet CD Proteins
  4. CD48
  5. SLAMF2/CD48 Protein, Rat (HEK293, His)

SLAMF2/CD48 Protein, Rat (HEK293, His)

Cat. No.: HY-P74541
COA Handling Instructions

SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag. The total length of SLAMF2/CD48 Protein, Rat (HEK293, His) is 194 a.a., with molecular weight of 32-50 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $60 In-stock
50 μg $170 In-stock
100 μg $290 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

SLAMF2/CD48 Protein, Rat (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag. The total length of SLAMF2/CD48 Protein, Rat (HEK293, His) is 194 a.a., with molecular weight of 32-50 kDa.

Background

SLAMF2, also known as CD48, is a glycosylphosphatidylinositol (GPI)-anchored cell surface glycoprotein that plays a crucial role in immune cell regulation. Through its N-terminal immunoglobulin domain, SLAMF2 interacts with cell surface receptors, such as 2B4/CD244 or CD2, to modulate immune cell function and activation. In T-cell signaling transduction, SLAMF2 forms complexes with CD2, facilitating the recruitment of the Src family protein kinase LCK and LAT to the TCR/CD3 complex. This interaction leads to the phosphorylation and subsequent activation of LCK. Additionally, SLAMF2 induces the phosphorylation of the cytoplasmic immunoreceptor tyrosine switch motifs (ITSMs) of CD244, initiating signaling events that culminate in the formation of the immunological synapse and the targeted release of cytolytic granules containing perforin and granzymes by T-lymphocytes and NK-cells. SLAMF2 establishes direct interactions with CD2, CD244, and LCK, contributing to its regulatory role in immune responses.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized 2B4/CD244 at 5μg/mL (100μL/well) can bind Rat SLAMF2. The ED50 for this effect is 2.78 μg/mL.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

P10252 (F23-R216)

Gene ID

245962  [NCBI]

Molecular Construction
N-term
CD48 (F23-R216)
Accession # P10252
His
C-term
Synonyms
CD48 antigen; SLAMF2; TCT.1; CD48; BCM1; BLAST1
AA Sequence

FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR

Molecular Weight

32-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SLAMF2/CD48 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74541
Quantity:
MCE Japan Authorized Agent: