SLAMF8 Protein, Mouse (HEK293, His)
SLAMF8 protein may contribute to B-lineage commitment and modulation of B-cell receptor signaling, playing a crucial role in B-cell development and immune responses. Exploring its molecular mechanisms and downstream effects could provide insights into its significance in B-cell biology. SLAMF8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SLAMF8 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SLAMF8 protein may contribute to B-lineage commitment and modulation of B-cell receptor signaling, playing a crucial role in B-cell development and immune responses. Exploring its molecular mechanisms and downstream effects could provide insights into its significance in B-cell biology. SLAMF8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SLAMF8 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The SLAMF8 protein emerges as a potential participant in B-lineage commitment, suggesting a role in the developmental processes that guide the differentiation of B-cells. Furthermore, SLAMF8 may be involved in modulating signaling through the B-cell receptor, indicating its influence on crucial cellular pathways associated with B-cell function. The dual potential of SLAMF8 in both B-lineage commitment and the regulation of B-cell receptor signaling underscores its importance in orchestrating key events in B-cell development and immune responses. Further exploration into the specific molecular mechanisms and downstream effects of SLAMF8 in these contexts could provide valuable insights into its functional significance and potential implications for B-cell biology.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9D3G2 (V21-D231)
-
Molecular Construction
-
N-term
-
SLAMF8 (V21-D231)
Accession # Q9D3G2 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SLAMF8; BCM-Like Membrane Protein; SLAM Family Member 8; B Lymphocyte Activator Macrophage Expressed; BLAME; B-Lymphocyte Activator Macrophage Expressed; SBBI42; CD353 Antigen; CD353
-
AA Sequence
VQVLSKVGDSELLVAECPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRVQLYDNLSLELGPLKPGDSGNFSVLMVDTGGQTWTQTLYLKVYDAVPKPEVQVFTAAAEETQPLNTCQVFLSCWAPNISDITYSWRWEGTVDFNGEVRSHFSNGQVLSVSLGLGDKDVAFTCIASNPVSWDMTTVTPWESCHHEAASGKASYKD
-
Predicted Molecular Mass
24.2 kDa
-
Molecular Weight
Approximately 32-38 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
