1. Recombinant Proteins
  2. Others
  3. SP-D Protein, Mouse (HEK293, His)

SP-D Protein, Mouse (HEK293, His)

Cat. No.: HY-P71329
SDS COA Handling Instructions

SP-D Protein (SP-D) enhances lung defense against microorganisms, antigens, and toxins.It interacts with lipopolysaccharides, oligosaccharides, and fatty acids, influencing immune responses.SP-D is involved in pulmonary surfactant turnover, maintaining lung homeostasis.It has a strong affinity for maltose residues and alpha-glucosyl moieties.Structurally, SP-D forms an oligomeric complex of homotrimers for effective pulmonary defense.SP-D Protein, Mouse (HEK293, His) is the recombinant mouse-derived SP-D protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SP-D Protein (SP-D) enhances lung defense against microorganisms, antigens, and toxins.It interacts with lipopolysaccharides, oligosaccharides, and fatty acids, influencing immune responses.SP-D is involved in pulmonary surfactant turnover, maintaining lung homeostasis.It has a strong affinity for maltose residues and alpha-glucosyl moieties.Structurally, SP-D forms an oligomeric complex of homotrimers for effective pulmonary defense.SP-D Protein, Mouse (HEK293, His) is the recombinant mouse-derived SP-D protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Surfactant protein D (SP-D) plays a vital role in bolstering the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. This multifaceted protein interacts with various compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, thereby modulating leukocyte responses in the immune system. Additionally, SP-D is implicated in the extracellular reorganization or turnover of pulmonary surfactant, contributing to the maintenance of lung homeostasis. Notably, SP-D exhibits a robust affinity for maltose residues and other alpha-glucosyl moieties. Structurally, it forms an oligomeric complex consisting of four sets of homotrimers, underscoring its intricate organization in pulmonary defense processes.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P50404 (A20-F374)

Gene ID
Molecular Construction
N-term
SP-D (A20-F374)
Accession # P50404
6*His
C-term
Synonyms
COLEC7; Collectin 7; Lung surfactant protein D; PSPD; pulmonary surfactant-associated protein D; SFTPD; SPD; SP-D; SP-Dpulmonary surfactant apoprotein; surfactant protein D; surfactant, pulmonary-associated protein D;
AA Sequence

AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEF

Molecular Weight

42-46 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 7.4 .

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SP-D Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SP-D Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71329
Quantity:
MCE Japan Authorized Agent: