SP-D Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

SP-D Protein (SP-D) enhances lung defense against microorganisms, antigens, and toxins.It interacts with lipopolysaccharides, oligosaccharides, and fatty acids, influencing immune responses.SP-D is involved in pulmonary surfactant turnover, maintaining lung homeostasis.It has a strong affinity for maltose residues and alpha-glucosyl moieties.Structurally, SP-D forms an oligomeric complex of homotrimers for effective pulmonary defense.SP-D Protein, Mouse (HEK293, His) is the recombinant mouse-derived SP-D protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SP-D Protein (SP-D) enhances lung defense against microorganisms, antigens, and toxins.It interacts with lipopolysaccharides, oligosaccharides, and fatty acids, influencing immune responses.SP-D is involved in pulmonary surfactant turnover, maintaining lung homeostasis.It has a strong affinity for maltose residues and alpha-glucosyl moieties.Structurally, SP-D forms an oligomeric complex of homotrimers for effective pulmonary defense.SP-D Protein, Mouse (HEK293, His) is the recombinant mouse-derived SP-D protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Surfactant protein D (SP-D) plays a vital role in bolstering the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. This multifaceted protein interacts with various compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, thereby modulating leukocyte responses in the immune system. Additionally, SP-D is implicated in the extracellular reorganization or turnover of pulmonary surfactant, contributing to the maintenance of lung homeostasis. Notably, SP-D exhibits a robust affinity for maltose residues and other alpha-glucosyl moieties. Structurally, it forms an oligomeric complex consisting of four sets of homotrimers, underscoring its intricate organization in pulmonary defense processes.

Verified Bioactivity

Measured by its ability to bind fluorescein-conjugated E. coli Bioparticles. The experiment was incubated at 37 ℃ for 2 h. The ED50 for this effect is 1.011 μg/mL.

MCE Validation Data

  • Bioactivity - Biochemical Activity Assay

    Bioactivity - Biochemical Activity Assay

    Measured by its ability to bind fluorescein-conjugated E. coli Bioparticles. The experiment was incubated at 37 ℃ for 2 h. The ED50 for this effect is 1.011 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SP-D (A20-F374)
      Accession # P50404
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SFTPD; Collectin-7; Prev. SFTP4; Surfactant, Pulmonary-Associated Protein D; COLEC7; Surfactant-Associated Protein, Pulmonary 4; SP-D; Pulmonary Surfactant Apoprotein; Pulmonary Surfactant-Associated Protein D; PSPD; Lung Surfactant Protein D; Surfactant

  • AA Sequence

    AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEF

  • Predicted Molecular Mass

    36.7 kDa

  • Molecular Weight

    Approximately 42 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 7.4 .

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00