SP-D Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
SP-D Protein (SP-D) enhances lung defense against microorganisms, antigens, and toxins.It interacts with lipopolysaccharides, oligosaccharides, and fatty acids, influencing immune responses.SP-D is involved in pulmonary surfactant turnover, maintaining lung homeostasis.It has a strong affinity for maltose residues and alpha-glucosyl moieties.Structurally, SP-D forms an oligomeric complex of homotrimers for effective pulmonary defense.SP-D Protein, Mouse (HEK293, His) is the recombinant mouse-derived SP-D protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SP-D Protein (SP-D) enhances lung defense against microorganisms, antigens, and toxins.It interacts with lipopolysaccharides, oligosaccharides, and fatty acids, influencing immune responses.SP-D is involved in pulmonary surfactant turnover, maintaining lung homeostasis.It has a strong affinity for maltose residues and alpha-glucosyl moieties.Structurally, SP-D forms an oligomeric complex of homotrimers for effective pulmonary defense.SP-D Protein, Mouse (HEK293, His) is the recombinant mouse-derived SP-D protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Surfactant protein D (SP-D) plays a vital role in bolstering the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. This multifaceted protein interacts with various compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, thereby modulating leukocyte responses in the immune system. Additionally, SP-D is implicated in the extracellular reorganization or turnover of pulmonary surfactant, contributing to the maintenance of lung homeostasis. Notably, SP-D exhibits a robust affinity for maltose residues and other alpha-glucosyl moieties. Structurally, it forms an oligomeric complex consisting of four sets of homotrimers, underscoring its intricate organization in pulmonary defense processes.
Verified Bioactivity
Measured by its ability to bind fluorescein-conjugated E. coli Bioparticles. The experiment was incubated at 37 ℃ for 2 h. The ED50 for this effect is 1.011 μg/mL.
MCE Validation Data
-
Bioactivity - Biochemical Activity Assay
Bioactivity - Biochemical Activity Assay
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P50404 (A20-F374)
-
Molecular Construction
-
N-term
-
SP-D (A20-F374)
Accession # P50404 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SFTPD; Collectin-7; Prev. SFTP4; Surfactant, Pulmonary-Associated Protein D; COLEC7; Surfactant-Associated Protein, Pulmonary 4; SP-D; Pulmonary Surfactant Apoprotein; Pulmonary Surfactant-Associated Protein D; PSPD; Lung Surfactant Protein D; Surfactant
-
AA Sequence
AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEF
-
Predicted Molecular Mass
36.7 kDa
-
Molecular Weight
Approximately 42 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 7.4 .
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)