SPINK4 Protein, Human (60a.a, HEK293, His)

SPINK4 Protein is a member of the serine protease inhibitors family named Kazal type (SPINK) in humans. SPINK4 is known as a gastrointestinal peptide in the gastrointestinal tract and is abundantly expressed in human goblet cells. SPINK4 can serve as a prognostic marker for colorectal cancer (CRC), bladder cancer (BCa) and Barrett's esophagus. The reduced expression of SPINK4 relates to poor survival in colorectal cancer (CRC)^[1][2]. SPINK4 Protein, Human (60a.a, HEK293, His) is the recombinant human-derived SPINK4 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SPINK4 Protein, Human (60a.a, HEK293, His) is 60 a.a., with molecular weight of ~10-13 kDa.

The SPINK4 gene of human chromosome 9p13.3 encodes a precursor protein consisting of 86 amino acids. The precursor protein consists of 26 amino acids, which are characterized by a C-terminal cysteine, an N-terminal glutamate and a cell secretion mark. A total of 60 residues of, are believed to be involved in the defense against degradation of mucosal and epithelial tissue proteins^[1].
One branch of the family of serine protease inhibitors is named Kazal type (SPINK) and originally consisted of four members in humans (SPINK1, SPINK2, SPINK4, and SPINK5). Although the major site of expression of all four SPINK members may differ, all are thought to be involved in protection against proteolytic degradation of epithelial and mucosal tissues^[2].

Human

HEK293

C-6*His

O60575 (G27-C86)

27290  [NCBI]

GKLPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQDIQIMKDGKC

Approximately 10-13 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, 1 mM EDTA, 5% Trehalose, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.