SPINK7 Protein, Human (HEK293, His)
Based on 1 Customer Validation
SPINK7 Protein, a probable serine protease inhibitor, suggests a role in modulating serine protease activity, crucial in diverse biological processes. Its participation likely regulates proteolytic activities, influencing cellular homeostasis and signaling pathways. SPINK7 Protein, Human (HEK293, His) is the recombinant human-derived SPINK7 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SPINK7 Protein, a probable serine protease inhibitor, suggests a role in modulating serine protease activity, crucial in diverse biological processes. Its participation likely regulates proteolytic activities, influencing cellular homeostasis and signaling pathways. SPINK7 Protein, Human (HEK293, His) is the recombinant human-derived SPINK7 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The SPINK7 protein is identified as a probable serine protease inhibitor. This characterization suggests its potential role in modulating the activity of serine proteases, enzymes involved in various biological processes. As a serine protease inhibitor, SPINK7 likely participates in the regulation of proteolytic activities, with implications for cellular homeostasis and the modulation of signaling pathways. Further investigation into the specific serine proteases targeted by SPINK7 and the biological contexts in which it functions will provide valuable insights into its role in cellular processes and potential therapeutic applications.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P58062 (S20-C85)
-
Molecular Construction
-
N-term
-
SPINK7 (S20-C85)
Accession # P58062 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SPINK7; ECRG-2; Serine Peptidase Inhibitor Kazal Type 7; Serine Peptidase Inhibitor, Kazal Type 7 (Putative); ECG2; Serine Peptidase Inhibitor Kazal Type 7 (Putative); ECRG2; Esophagus Cancer Related Gene 2; Esophagus Cancer-Related Gene 2 Protein; Esopha
-
AA Sequence
SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC
-
Predicted Molecular Mass
8.2 kDa
-
Molecular Weight
Approximately 12 kDa & 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
