Copy Link Print Information

Spondin-2/SPON2 Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Spondin-2 protein is a matricellular protein with antigen binding, lipopolysaccharide binding and metal ion binding activity. Spondin-2 is essential for recruiting lymphocytes and initiating immune responses while being involved in cell adhesion, defense response to other organism; opsonization; and positive regulation of cytokine production. Spondin-2 is found to promote infiltration of M1-like macrophages and inhibits tumor metastasis in cancer research. Spondin-2/SPON2 Protein, Human (HEK293, His) is the recombinant human-derived Spondin-2/SPON2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Spondin-2/SPON2 Protein, Human (HEK293, His)
  • Spondin-2/SPON2 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Spondin-2 protein is a matricellular protein with antigen binding, lipopolysaccharide binding and metal ion binding activity. Spondin-2 is essential for recruiting lymphocytes and initiating immune responses while being involved in cell adhesion, defense response to other organism; opsonization; and positive regulation of cytokine production. Spondin-2 is found to promote infiltration of M1-like macrophages and inhibits tumor metastasis in cancer research. Spondin-2/SPON2 Protein, Human (HEK293, His) is the recombinant human-derived Spondin-2/SPON2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Spondin-2 protein is a matricellular protein and a member of Mindin F-Spondin family with antigen binding, lipopolysaccharide binding and metal ion binding activity. Spondin-2 is essential for recruiting lymphocytes and initiating immune responses, represents a unique a pattern recognition molecule for microbial pathogens. Spondin-2 is involved in cell adhesion and act upstream of or within several processes, including defense response to other organism; opsonization; and positive regulation of cytokine production. Spondin-2 also functions as an integrin ligand for inflammatory cell recruitment and T-cell priming. The binding of bacteria by Spondin-2 promotes phagocytosis of the bacterium and stimulates the production of proinflammatory cytokines by the macrophage. Spondin-2 is found to promote infiltration of M1-like macrophages and inhibits tumor metastasis in cancer research[1][2][3].

Verified Bioactivity

Measured by the ability to enhance BMP-2 induced alkaline phosphatase activity in MC3T3-E1 cells. The ED50 for this effect is approximately 0.949 μg/mL in the presence of 0.113 μg/mL of BMP-2, corresponding to a specific activity is 1.054×103 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    AAH02707.1 (Q27-V331)

  • Gene ID
    10417  [NCBI]
  • Molecular Construction
    • N-term
    • SPON2 (Q27-V331)
      Accession # AAH02707.1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Spondin-2 Chain

  • Synonyms

    SPON2; Spondin 2, Extracellular Matrix Protein; Spondin 2; M-Spondin; DIL1; Spondin-2; Mindin; DIL-1; Differentially Expressed In Cancerous And Non-Cancerous Lung Cells 1

  • AA Sequence

    QPLGGESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVTLLRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV

  • Predicted Molecular Mass

    34.4 kDa

  • Molecular Weight

    Approximately 38-42 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Spondin-2/SPON2 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Spondin-2/SPON2 Protein, Human (HEK293, His)
  • Spondin-2/SPON2 Protein, Human (HEK293, His) Product Image