Spondin-2/SPON2 Protein, Human (HEK293, His)

Spondin-2 protein is a matricellular protein with antigen binding, lipopolysaccharide binding and metal ion binding activity. Spondin-2 is essential for recruiting lymphocytes and initiating immune responses while being involved in cell adhesion, defense response to other organism; opsonization; and positive regulation of cytokine production. Spondin-2 is found to promote infiltration of M1-like macrophages and inhibits tumor metastasis in cancer research. Spondin-2/SPON2 Protein, Human (HEK293, His) is the recombinant human-derived Spondin-2/SPON2 protein, expressed by HEK293 , with C-6*His labeled tag.

Spondin-2 protein is a matricellular protein and a member of Mindin F-Spondin family with antigen binding, lipopolysaccharide binding and metal ion binding activity. Spondin-2 is essential for recruiting lymphocytes and initiating immune responses, represents a unique a pattern recognition molecule for microbial pathogens. Spondin-2 is involved in cell adhesion and act upstream of or within several processes, including defense response to other organism; opsonization; and positive regulation of cytokine production. Spondin-2 also functions as an integrin ligand for inflammatory cell recruitment and T-cell priming. The binding of bacteria by Spondin-2 promotes phagocytosis of the bacterium and stimulates the production of proinflammatory cytokines by the macrophage. Spondin-2 is found to promote infiltration of M1-like macrophages and inhibits tumor metastasis in cancer research^[1][2][3].

Measured by the ability to enhance BMP-2 induced alkaline phosphatase activity in MC3T3-E1 cells. The ED₅₀ for this effect is approximately 0.949 μg/mL in the presence of 0.113 μg/mL of BMP-2, corresponding to a specific activity is 1.054×10³ units/mg.

Human

HEK293

C-6*His

AAH02707.1 (Q27-V331)

10417  [NCBI]

Partial

QPLGGESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVTLLRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV

Approximately 38-47 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/kyse-520-cell-line-cell.html  [Content Brief]