1. Recombinant Proteins
  2. Others
  3. Spondin-2/SPON2 Protein, Human (HEK293, His)

Spondin-2/SPON2 Protein, Human (HEK293, His)

Cat. No.: HY-P70142
COA Handling Instructions

Spondin-2 protein is a matricellular protein with antigen binding, lipopolysaccharide binding and metal ion binding activity. Spondin-2 is essential for recruiting lymphocytes and initiating immune responses while being involved in cell adhesion, defense response to other organism; opsonization; and positive regulation of cytokine production. Spondin-2 is found to promote infiltration of M1-like macrophages and inhibits tumor metastasis in cancer research. Spondin-2/SPON2 Protein, Human (HEK293, His) is the recombinant human-derived Spondin-2/SPON2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Spondin-2/SPON2 Protein, Human (HEK293, His) is 305 a.a., with molecular weight of 38-42 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $85 In-stock
50 μg $255 In-stock
100 μg $400 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Spondin-2/SPON2 Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Spondin-2 protein is a matricellular protein with antigen binding, lipopolysaccharide binding and metal ion binding activity. Spondin-2 is essential for recruiting lymphocytes and initiating immune responses while being involved in cell adhesion, defense response to other organism; opsonization; and positive regulation of cytokine production. Spondin-2 is found to promote infiltration of M1-like macrophages and inhibits tumor metastasis in cancer research. Spondin-2/SPON2 Protein, Human (HEK293, His) is the recombinant human-derived Spondin-2/SPON2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Spondin-2/SPON2 Protein, Human (HEK293, His) is 305 a.a., with molecular weight of 38-42 kDa.

Background

Spondin-2 protein is a matricellular protein and a member of Mindin F-Spondin family with antigen binding, lipopolysaccharide binding and metal ion binding activity. Spondin-2 is essential for recruiting lymphocytes and initiating immune responses, represents a unique a pattern recognition molecule for microbial pathogens. Spondin-2 is involved in cell adhesion and act upstream of or within several processes, including defense response to other organism; opsonization; and positive regulation of cytokine production. Spondin-2 also functions as an integrin ligand for inflammatory cell recruitment and T-cell priming. The binding of bacteria by Spondin-2 promotes phagocytosis of the bacterium and stimulates the production of proinflammatory cytokines by the macrophage. Spondin-2 is found to promote infiltration of M1-like macrophages and inhibits tumor metastasis in cancer research[1][2][3].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH02707.1 (Q27-V331)

Gene ID
Molecular Construction
N-term
SPON2 (Q27-V331)
Accession # AAH02707.1
6*His
C-term
Synonyms
rHuSpondin-2/SPON2, His; Spondin-2; Differentially expressed in cancerous and non-cancerous lung cells 1; DIL-1; Mindin; SPON2
AA Sequence

QPLGGESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVTLLRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV

Molecular Weight

38-42 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Spondin-2/SPON2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Spondin-2/SPON2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70142
Quantity:
MCE Japan Authorized Agent: