SSTR2 Protein-VLP, Human (HEK293, His)
Based on 1 Customer Validation
SSTR2 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA, FACS. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SSTR2 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA, FACS. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.
Background
The SSTR2 Protein-VLP serves as a receptor for somatostatin-14 and -28, coupling with pertussis toxin-sensitive G proteins to inhibit adenylyl cyclase. Additionally, it stimulates phosphotyrosine phosphatase and PLC through pertussis toxin-insensitive and sensitive G proteins, while inhibiting calcium entry by suppressing voltage-dependent calcium channels. In pancreatic alpha- and beta-cells, SSTR2 acts as the functionally dominant somatostatin receptor, mediating the inhibitory effects of somatostatin-14 on hormone secretion. Beyond its role in pancreatic cells, SSTR2 inhibits cell growth by enhancing MAPK1 and MAPK2 phosphorylation, leading to the up-regulation of CDKN1B. It further contributes to neuronal migration and axon outgrowth, potentially participating in neuron development and maturation during brain development. SSTR2 mediates the negative regulation of insulin receptor signaling through PTPN6 and inactivates SSTR3 receptor function following heterodimerization. Existing as both homodimers and heterodimers with SSTR3 and SSTR5, SSTR2 undergoes agonist-induced dissociation into monomers, a crucial step for receptor internalization. Interactions with beta-arrestin and SHANK1 further modulate receptor internalization and function.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human SSTR2 at 1 μg/well can bind Anti-SSTR2 recombinant antibod, the EC50is 70.87 - 130.6 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P30874 (M1-I369)
-
Molecular Construction
-
N-term
-
SSTR2-VLP (M1-I369)
Accession # P30874 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
SSTR2; SST2; Somatostatin Receptor 2; SS2R; Somatostatin Receptor Type 2; SS-2-R; SRIF-1; SS2-R
-
AA Sequence
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
-
Predicted Molecular Mass
42.5 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
Purity analysis by SDS-PAGE is not available for VLP proteins.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)