1. Recombinant Proteins
  2. Others
  3. STAT3 Protein, Human (His)

STAT3 is a signal transducer and transcriptional activator that coordinates diverse cellular processes in response to growth factors and cytokines such as interleukin-6 and KITLG/SCF. Upon activation, STAT3 recruits coactivators to target gene promoters, thereby affecting proliferation, differentiation, and immune responses. STAT3 Protein, Human (His) is the recombinant human-derived STAT3 protein, expressed by E. coli , with C-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

STAT3 is a signal transducer and transcriptional activator that coordinates diverse cellular processes in response to growth factors and cytokines such as interleukin-6 and KITLG/SCF. Upon activation, STAT3 recruits coactivators to target gene promoters, thereby affecting proliferation, differentiation, and immune responses. STAT3 Protein, Human (His) is the recombinant human-derived STAT3 protein, expressed by E. coli , with C-6*His labeled tag.

Background

STAT3, a signal transducer and transcription activator, orchestrates cellular responses to various growth factors, interleukins, and cytokines. Upon activation, STAT3 recruits coactivators to the promoter region of target genes, thereby mediating diverse cellular processes such as proliferation, differentiation, and immune response regulation. It responds to signaling from interleukin-6, KITLG/SCF, and other growth factors, facilitating a cascade of downstream events. Additionally, STAT3 plays a role in cell cycle regulation, inflammatory response modulation, and energy homeostasis. Its functions extend to influencing apoptosis, melanocortin production, and insulin secretion. The protein's activation involves homodimerization or heterodimerization with related family members. STAT3 interacts with an array of molecules, including IL31RA, NCOA1, PELP1, SIPAR, SOCS7, STATIP1, and others, contributing to its intricate involvement in cellular signaling pathways.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P40763-1 (M1-N175)

Gene ID
Molecular Construction
N-term
STAT3 (M1-N175)
Accession # P40763-1
6*His
C-term
Protein Length

Partial

Synonyms
Signal Transducer and Activator of Transcription 3; Acute-Phase Response Factor; STAT3; APRF
AA Sequence

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFN

Predicted Molecular Mass
21.8 kDa
분자량

Approximately 19 kDa & 46 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or 20mM Tris-HCl, 10% Trehalose, 50mM NaCl, 0.05% Tween 80, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

STAT3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

STAT3 Protein, Human (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
STAT3 Protein, Human (His)
Cat. No.:
HY-P70574
수량:
MCE Japan Authorized Agent: