Statherin Protein, Human (HEK293, Fc)

Statherin, a salivary protein, crucially regulates saliva's calcium salt supersaturation by inhibiting calcium phosphate salt precipitation. Beyond preventing crystallization, statherin significantly influences hydroxyapatite crystal formation on teeth, highlighting its dual role in dental health. It prevents undesirable mineral deposition and impacts tooth mineralization dynamics. Statherin Protein, Human (HEK293, Fc) is the recombinant human-derived Statherin protein, expressed by HEK293 , with C-mFc labeled tag.

Statherin, a salivary protein, serves as a crucial regulator in maintaining saliva supersaturated with calcium salts by effectively inhibiting the precipitation of calcium phosphate salts. Beyond its role in preventing the unwanted crystallization of calcium phosphate, statherin plays a significant role in modulating the formation of hydroxyapatite crystals on the tooth surface. This dual function underscores the importance of statherin in dental health, contributing to the prevention of undesirable mineral deposition and influencing the dynamics of tooth mineralization.

Human

HEK293

C-mFc

P02808-1 (M1-F62)

6779  [NCBI]

Full Length of Isoform-1

MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF

Approximately 36 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.